Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

TIN2/TINF2 Rabbit mAb (A9750)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - TIN2/TINF2 Rabbit mAb (A9750)

Western blot analysis of extracts of various cell lines, using TIN2/TINF2 Rabbit mAb (A9750) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

You may also interested in:

Overview

Product name TIN2/TINF2 Rabbit mAb
Catalog No. A9750
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC1732

Background

This gene encodes one of the proteins of the shelterin, or telosome, complex which protects telomeres by allowing the cell to distinguish between telomeres and regions of DNA damage. The protein encoded by this gene is a critical part of shelterin; it interacts with the three DNA-binding proteins of the shelterin complex, and it is important for assembly of the complex. Mutations in this gene cause dyskeratosis congenita (DKC), an inherited bone marrow failure syndrome.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 210-309 of human TIN2/TINF2 (Q9BSI4).
Sequence NLAEPMEQNPPQQQRLALHNPLPKAKPGTHLPQGPSSRTHPEPLAGRHFNLAPLGRRRVQSQWASTRGGHKERPTVMLFPFRNLGSPTQVISKPESKEEH
Gene ID 26277
Swiss prot Q9BSI4
Synonyms TIN2; DKCA3; TIN2/TINF2
Calculated MW 50kDa
Observed MW 45kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Hep G2, A549, Mouse testis, Mouse thymus, Rat lung, Rat testis
Cellular location Chromosome, Nucleus, Nucleus matrix, telomere
Customer validation

WB (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

TIN2/TINF2 Rabbit mAb images

ABclonal:Western blot - TIN2/TINF2 Rabbit mAb (A9750)}

Western blot - TIN2/TINF2 Rabbit mAb (A9750)

Western blot analysis of extracts of various cell lines, using TIN2/TINF2 Rabbit mAb (A9750) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Inquire About This Product

Submit your question about A9750 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TINF2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TINF2. (Distance between topics and target gene indicate popularity.) TINF2

* Data provided by citexs.com, for reference only.

Publishing research using A9750? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order