Publications (2) Datasheet SDS
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | TGFBR3 Rabbit pAb |
---|---|
Catalog No. | A0627 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 140-340 of human TGFBR3 (NP_003234.2). |
---|---|
Sequence | ANFSLTAETEERNFPHGNEHLLNWARKEYGAVTSFTELKIARNIYIKVGEDQVFPPKCNIGKNFLSLNYLAEYLQPKAAEGCVMSSQPQNEEVHIIELITPNSNPYSAFQVDITIDIRPSQEDLEVVKNLILILKCKKSVNWVIKSFDVKGSLKIIAPNSIGFGKESERSMTMTKSIRDDIPSTQGNLVKWALDNGYSPIT |
Gene ID | 7049 |
Swiss prot | Q03167 |
Synonyms | BGCAN; betaglycan; TGFBR3 |
Calculated MW | 93kDa |
Observed MW | 110kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | SH-SY5Y, Mouse brain, Mouse lung, Rat brain |
Cellular location | Cell membrane, Secreted, Single-pass type I membrane protein, extracellular space |
Customer validation | WB (Homo sapiens) IF (Rattus norvegicus) |
Submit your question about A0627 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on TGFBR3. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to TGFBR3. (Distance between topics and target gene indicate popularity.) TGFBR3
* Data provided by citexs.com, for reference only.
Publishing research using A0627? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.