Product name | TFRC Rabbit pAb |
---|---|
Catalog No. | A5865 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human TFRC (NP_001121620.1). |
---|---|
Sequence | MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAVDEEENADNNTKANVTKPKRCSGSICYGTIAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDF |
Gene ID | 7037 |
Swiss prot | P02786 |
Synonyms | TFRC; CD71; IMD46; T9; TFR; TFR1; TR; TRFR; p90 |
Calculated MW | 84kDa |
Observed MW | 100kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | HeLa, Raji, HepG2, Jurkat, Mouse spleen, Mouse liver, Rat spleen |
Cellular location | Cell membrane, Melanosome, Secreted, Single-pass type II membrane protein |
Customer validation | WB(Homo sapiens, Rattus norvegicus, Mus musculus) IF(Rattus norvegicus) |
Submit your question about A5865 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A5865? Please let us know so that we can cite the reference in this datasheet.