Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

TFAM Rabbit mAb (A3173)

Publications (8) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - TFAM Rabbit mAb (A3173)

Western blot analysis of various lysates, using TFAM Rabbit pAb (A3173) at 1:6000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - TFAM Rabbit mAb (A3173)

Immunohistochemistry analysis of TFAM in paraffin-embedded human brain tissue using TFAM Rabbit mAb (A3173) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - TFAM Rabbit mAb (A3173)

Immunohistochemistry analysis of TFAM in paraffin-embedded human colon carcinoma tissue using TFAM Rabbit mAb (A3173) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - TFAM Rabbit mAb (A3173)

Immunohistochemistry analysis of TFAM in paraffin-embedded human thyroid cancer tissue using TFAM Rabbit mAb (A3173) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - TFAM Rabbit mAb (A3173)

Confocal imaging of paraffin-embedded Human kidney tissue using TFAM Rabbit mAb (A3173, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

ABclonal:Immunofluorescence - TFAM Rabbit mAb (A3173)

Confocal imaging of paraffin-embedded Human colon cancer tissue using TFAM Rabbit mAb (A3173, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

You may also interested in:

Overview

Product name TFAM Rabbit mAb
Catalog No. A3173
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC51776

Background

This gene encodes a key mitochondrial transcription factor containing two high mobility group motifs. The encoded protein also functions in mitochondrial DNA replication and repair. Sequence polymorphisms in this gene are associated with Alzheimer's and Parkinson's diseases. There are pseudogenes for this gene on chromosomes 6, 7, and 11. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TFAM (NP_003192.1).
Sequence QDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELY
Gene ID 7019
Swiss prot Q00059
Synonyms TCF6; MTTF1; MTTFA; TCF6L1; TCF6L2; TCF6L3; MTDPS15; TFAM
Calculated MW 29kDa
Observed MW 24kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouseRat
IHC-P HumanRat
Recommended dilution
  • WB 1:1000 - 1:10000
  • IHC-P 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, HepG2, Mouse thymus, Rat heart
Cellular location Mitochondrion, Mitochondrion matrix, mitochondrion nucleoid
Customer validation

IF (Homo sapiens)

WB (Mus musculus, Homo sapiens, Rattus norvegicus, Gallus gallus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TFAM Rabbit mAb images

ABclonal:Western blot - TFAM Rabbit mAb (A3173)}

Western blot - TFAM Rabbit mAb (A3173)

Western blot analysis of various lysates, using TFAM Rabbit pAb (A3173) at 1:6000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - TFAM Rabbit mAb (A3173)}

Immunohistochemistry - TFAM Rabbit mAb (A3173)

Immunohistochemistry analysis of TFAM in paraffin-embedded human brain tissue using TFAM Rabbit mAb (A3173) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - TFAM Rabbit mAb (A3173)}

Immunohistochemistry - TFAM Rabbit mAb (A3173)

Immunohistochemistry analysis of TFAM in paraffin-embedded human colon carcinoma tissue using TFAM Rabbit mAb (A3173) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - TFAM Rabbit mAb (A3173)}

Immunohistochemistry - TFAM Rabbit mAb (A3173)

Immunohistochemistry analysis of TFAM in paraffin-embedded human thyroid cancer tissue using TFAM Rabbit mAb (A3173) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunofluorescence - TFAM Rabbit mAb (A3173)}

Immunofluorescence - TFAM Rabbit mAb (A3173)

Confocal imaging of paraffin-embedded Human kidney tissue using TFAM Rabbit mAb (A3173, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
ABclonal:Immunofluorescence - TFAM Rabbit mAb (A3173)}

Immunofluorescence - TFAM Rabbit mAb (A3173)

Confocal imaging of paraffin-embedded Human colon cancer tissue using TFAM Rabbit mAb (A3173, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Inquire About This Product

Submit your question about A3173 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TFAM. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TFAM. (Distance between topics and target gene indicate popularity.) TFAM

* Data provided by citexs.com, for reference only.

Publishing research using A3173? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order