Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TET2 Rabbit pAb (A1526)

Publications (4) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - TET2 Rabbit pAb (A1526)

Western blot analysis of extracts of Mouse heart, using TET2 antibody (A1526) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - TET2 Rabbit pAb (A1526)

Immunohistochemistry analysis of paraffin-embedded human colon using TET2 antibody (A1526) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - TET2 Rabbit pAb (A1526)

Immunohistochemistry analysis of paraffin-embedded rat bone marrow using TET2 antibody (A1526) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name TET2 Rabbit pAb
Catalog No. A1526
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a methylcytosine dioxygenase that catalyzes the conversion of methylcytosine to 5-hydroxymethylcytosine. The encoded protein is involved in myelopoiesis, and defects in this gene have been associated with several myeloproliferative disorders. Two variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1833-2002 of human TET2 (NP_001120680.1).
Sequence VQGVASGAEDNDEVWSDSEQSFLDPDIGGVAVAPTHGSILIECAKRELHATTPLKNPNRNHPTRISLVFYQHKSMNEPKHGLALWEAKMAEKAREKEEECEKYGPDYVPQKSHGKKVKREPAEPHETSEPTYLRFIKSLAERTMSVTTDSTVTTSPYAFTRVTGPYNRYI
Gene ID 54790
Swiss prot Q6N021
Synonyms MDS; IMD75; KIAA1546; TET2
Calculated MW 224kDa
Observed MW 250kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Mouse heart
Cellular location nucleus
Customer validation

ChIP (Mus musculus)

WB (Mus musculus)

FC (Rattus norvegicus)

IHC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TET2 Rabbit pAb images

ABclonal:Western blot - TET2 Rabbit pAb (A1526)}

Western blot - TET2 Rabbit pAb (A1526)

Western blot analysis of extracts of Mouse heart, using TET2 antibody (A1526) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - TET2 Rabbit pAb (A1526)}

Immunohistochemistry - TET2 Rabbit pAb (A1526)

Immunohistochemistry analysis of paraffin-embedded human colon using TET2 antibody (A1526) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - TET2 Rabbit pAb (A1526)}

Immunohistochemistry - TET2 Rabbit pAb (A1526)

Immunohistochemistry analysis of paraffin-embedded rat bone marrow using TET2 antibody (A1526) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A1526 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TET2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TET2. (Distance between topics and target gene indicate popularity.) TET2

* Data provided by citexs.com, for reference only.

Publishing research using A1526? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Proteins (4)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order