Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

TET1 Rabbit mAb (A23162)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - TET1 Rabbit mAb (A23162)

Western blot analysis of various lysates, using TET1 antibody (A23162) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

You may also interested in:

Overview

Product name TET1 Rabbit mAb
Catalog No. A23162
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC59030

Background

DNA methylation is an epigenetic mechanism that is important for controlling gene expression. The protein encoded by this gene is a demethylase that belongs to the TET (ten-eleven translocation) family. Members of the TET protein family play a role in the DNA methylation process and gene activation.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1800-1900 of human TET (NP_085128.2).
Sequence TLGSNTETVQPEVKSETEPHFILKSSDNTKTYSLMPSAPHPVKEASPGFSWSPKTASATPAPLKNDATASCGFSERSSTPHCTMPSGRLSGANAAAADGPG
Gene ID 80312
Swiss prot Q8NFU7
Synonyms LCX; CXXC6; bA119F7.1; TET1
Calculated MW 235kDa
Observed MW 310kDa

Applications

Reactivity Human, Mouse
Tested applications Testing results
WB HumanMouse
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Hep G2, Mouse brain
Cellular location Nucleus
Customer validation

WB (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TET1 Rabbit mAb images

ABclonal:Western blot - TET1 Rabbit mAb (A23162)}

Western blot - TET1 Rabbit mAb (A23162)

Western blot analysis of various lysates, using TET1 antibody (A23162) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Inquire About This Product

Submit your question about A23162 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TET1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TET1. (Distance between topics and target gene indicate popularity.) TET1

* Data provided by citexs.com, for reference only.

Publishing research using A23162? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order