Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TCF1/TCF7 Rabbit pAb (A3091)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - TCF1/TCF7 Rabbit pAb (A3091)

Western blot analysis of extracts of various cell lines, using TCF1/TCF7 antibody (A3091) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

You may also interested in:

Overview

Product name TCF1/TCF7 Rabbit pAb
Catalog No. A3091
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the T-cell factor/lymphoid enhancer-binding factor family of high mobility group (HMG) box transcriptional activators. This gene is expressed predominantly in T-cells and plays a critical role in natural killer cell and innate lymphoid cell development. The encoded protein forms a complex with beta-catenin and activates transcription through a Wnt/beta-catenin signaling pathway. Mice with a knockout of this gene are viable and fertile, but display a block in T-lymphocyte differentiation. Alternative splicing results in multiple transcript variants. Naturally-occurring isoforms lacking the N-terminal beta-catenin interaction domain may act as dominant negative regulators of Wnt signaling.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human TCF1/TCF7 (NP_003193.2).
Sequence ELKSSLVNESEGAAGGAGIPGVPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKETVYSAFNLLMHYPPPSGAGQHPQPQPPLHKA
Gene ID 6932
Swiss prot P36402
Synonyms TCF-1; TCF1/TCF7
Calculated MW 42kDa
Observed MW 28-50kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HT-29, Jurkat, Mouse spleen, Mouse thymus, Rat lung, Rat spleen
Cellular location Nucleus
Customer validation

WB (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TCF1/TCF7 Rabbit pAb images

ABclonal:Western blot - TCF1/TCF7 Rabbit pAb (A3091)}

Western blot - TCF1/TCF7 Rabbit pAb (A3091)

Western blot analysis of extracts of various cell lines, using TCF1/TCF7 antibody (A3091) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Inquire About This Product

Submit your question about A3091 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TCF7. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TCF7. (Distance between topics and target gene indicate popularity.) TCF7

* Data provided by citexs.com, for reference only.

Publishing research using A3091? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order