Product Type > Antibodies > Primary Antibodies > Methyl-specific Antibodies

Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range)

ABclonal:Western blot - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Western blot analysis of various lysates, using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Western blot analysis of various lysates, using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Dot Blot - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Dot-blot analysis of all sorts of methylation peptides using Symmetric DiMethyl-Histone H4-R3 antibody (A3159).

ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded mouse intestin tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded rat colon tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded mouse spleen tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded human liver tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded human cervix cancer tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded mouse brain tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded human spleen tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded rat brain tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded rat liver tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded human colon tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded human colon carcinoma tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunofluorescence analysis of 293T cells using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name	Symmetric DiMethyl-Histone H4-R3 Rabbit pAb
Catalog No.	A3159
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in a histone cluster on chromosome 1. This gene is one of four histone genes in the cluster that are duplicated; this record represents the centromeric copy.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H4 (NP_003529.1).
Sequence	MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
Gene ID	8359
Swiss prot	P62805
Synonyms	H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; Symmetric DiMethyl-Histone H4-R3
Calculated MW	11kDa
Observed MW	15kDa

Applications

Reactivity	Human, Mouse, Rat, Other (Wide Range)
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution	DB 1:500 - 1:2000 WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, C2C12, C6
Cellular location	Chromosome, Nucleus
Customer validation	WB (Danio rerio ) WB (Homo sapiens, Rattus norvegicus, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Research Area & PathwaysProtein phosphorylation

Symmetric DiMethyl-Histone H4-R3 Rabbit pAb images

Western blot - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Dot Blot - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Dot-blot analysis of all sorts of methylation peptides using Symmetric DiMethyl-Histone H4-R3 antibody (A3159).

Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunofluorescence - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunofluorescence analysis of 293T cells using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159). Blue: DAPI for nuclear staining.

Product Protocols

Inquire About This Product

Submit your question about A3159 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

*Your Question

*First Name

*Last Name

*Work Email

*Phone

*Institution

Related Targets

Based on existing publications, the following genes are closely related to research on H4C14. (Numbers indicate number of published articles where both targets appear.)

◀1/▶

Related Research Area

Based on existing publications, the following research topics are related to H4C14. (Distance between topics and target gene indicate popularity.) H4C14

* Data provided by citexs.com, for reference only.

References for Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Product:

Symmetric DiMethyl-Histone H4-R3 Rabbit pAb

Journal:

Development (Cambridge, England)

Application:

IF:

6.86

Species:

Danio rerio

PMID:

31533925

Title:

Zebrafish prmt5 arginine methyltransferase is essential for germ cell development

References for Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Product:

Symmetric DiMethyl-Histone H4-R3 Rabbit pAb

Journal:

Molecular & cellular proteomics : MCP

Application:

IF:

5.91

Species:

Homo sapiens

PMID:

32868396

Title:

Glutathionylation decreases methyltransferase activity of PRMT5 and inhibits cell proliferation

References for Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Product:

Symmetric DiMethyl-Histone H4-R3 Rabbit pAb

Journal:

Biological trace element research

Application:

IF:

4.08

Species:

Rattus norvegicus

PMID:

36823489

Title:

Sub-Chronic Aluminum Exposure in Rats' Learning-Memory Capability and Hippocampal Histone H4 Acetylation Modification: Effects and Mechanisms

References for Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Product:

Symmetric DiMethyl-Histone H4-R3 Rabbit pAb

Journal:

International journal of molecular sciences

Application:

IF:

6.2

Species:

Mus musculus

PMID:

36901758

Title:

(S)-2-(Cyclobutylamino)-N-(3-(3,4-dihydroisoquinolin-2(1H)-yl)-2-hydroxypropyl)isonicotinamide Attenuates RANKL-Induced Osteoclast Differentiation by Inhibiting NF-κB Nuclear Translocation - PMC