Product Type > Antibodies > Primary Antibodies > Methyl-specific Antibodies

Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Publications (4) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range)

ABclonal:Symmetric DiMethyl-Histone H4-R3 Rabbit pAb
ABclonal:Western blot - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Western blot analysis of various lysates, using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Western blot - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Western blot analysis of various lysates, using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Dot Blot - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Dot-blot analysis of all sorts of methylation peptides using Symmetric DiMethyl-Histone H4-R3 antibody (A3159).

ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded mouse intestin tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of  1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded rat colon tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of  1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded mouse spleen tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of  1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded human liver tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of  1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded human cervix cancer tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of  1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded mouse brain tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of  1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded human spleen tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of  1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded rat brain tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of  1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded rat liver tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of  1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded human colon tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of  1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded human colon carcinoma tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of  1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunofluorescence analysis of 293T cells using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Symmetric DiMethyl-Histone H4-R3 Rabbit pAb
Catalog No. A3159
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in a histone cluster on chromosome 1. This gene is one of four histone genes in the cluster that are duplicated; this record represents the centromeric copy.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H4 (NP_003529.1).
Sequence MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
Gene ID 8359
Swiss prot P62805
Synonyms H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; Symmetric DiMethyl-Histone H4-R3
Calculated MW 11kDa
Observed MW 15kDa

Applications

Reactivity Human, Mouse, Rat, Other (Wide Range)
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • DB 1:500 - 1:2000
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, C2C12, C6
Cellular location Chromosome, Nucleus
Customer validation

 WB (Danio rerio )

WB (Homo sapiens, Rattus norvegicus, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Symmetric DiMethyl-Histone H4-R3 Rabbit pAb images

ABclonal:Western blot - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)}

Western blot - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Western blot analysis of various lysates, using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Western blot - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)}

Western blot - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Western blot analysis of various lysates, using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Dot Blot - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)}

Dot Blot - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Dot-blot analysis of all sorts of methylation peptides using Symmetric DiMethyl-Histone H4-R3 antibody (A3159).
ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)}

Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded mouse intestin tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of  1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)}

Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded rat colon tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of  1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)}

Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded mouse spleen tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of  1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)}

Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded human liver tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of  1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)}

Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded human cervix cancer tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of  1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)}

Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded mouse brain tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of  1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)}

Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded human spleen tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of  1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)}

Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded rat brain tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of  1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)}

Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded rat liver tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of  1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)}

Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded human colon tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of  1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)}

Immunohistochemistry - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H4-R3 in paraffin-embedded human colon carcinoma tissue using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159) at a dilution of  1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunofluorescence - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)}

Immunofluorescence - Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159)

Immunofluorescence analysis of 293T cells using Symmetric DiMethyl-Histone H4-R3 Rabbit pAb (A3159). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A3159 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on H4C14. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to H4C14. (Distance between topics and target gene indicate popularity.) H4C14

* Data provided by citexs.com, for reference only.

Publishing research using A3159? Please let us know so that we can cite the reference in this datasheet.

Antibodies (32)

Secondary Antibodies (22)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order