Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Survivin Rabbit pAb (A1551)

Publications (21) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Survivin Rabbit pAb (A1551)

Western blot analysis of various lysates, using Survivin antibody (A1551) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - Survivin Rabbit pAb (A1551)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Survivin Rabbit pAb (A1551) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Survivin Rabbit pAb (A1551)

Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using Survivin Rabbit pAb (A1551) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Survivin Rabbit pAb (A1551)

Immunohistochemistry analysis of paraffin-embedded human tonsil using Survivin Rabbit pAb (A1551) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Survivin Rabbit pAb (A1551)

Immunohistochemistry analysis of paraffin-embedded mouse fetal liver using Survivin Rabbit pAb (A1551) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name Survivin Rabbit pAb
Catalog No. A1551
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is a member of the inhibitor of apoptosis (IAP) gene family, which encode negative regulatory proteins that prevent apoptotic cell death. IAP family members usually contain multiple baculovirus IAP repeat (BIR) domains, but this gene encodes proteins with only a single BIR domain. The encoded proteins also lack a C-terminus RING finger domain. Gene expression is high during fetal development and in most tumors, yet low in adult tissues. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human Survivin (NP_001159.2).
Sequence MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAEKVRRAIEQLAAMD
Gene ID 332
Swiss prot O15392
Synonyms API4; EPR-1; Survivin
Calculated MW 16kDa
Observed MW 16kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HeLa, 293F, Jurkat
Cellular location Chromosome, Cytoplasm, Midbody, Nucleus, centromere, cytoskeleton, kinetochore, spindle
Customer validation

WB (Mus musculus, Rattus norvegicus, Homo sapiens, African green monkey, Micropterus salmoides)

IF (Homo sapiens, Mus musculus)

FC (Homo sapiens)

ICC (Homo sapiens)

ChIP (Mus musculus)

IHC (Micropterus salmoides)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Survivin Rabbit pAb images

ABclonal:Western blot - Survivin Rabbit pAb (A1551)}

Western blot - Survivin Rabbit pAb (A1551)

Western blot analysis of various lysates, using Survivin antibody (A1551) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - Survivin Rabbit pAb (A1551)}

Immunohistochemistry - Survivin Rabbit pAb (A1551)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Survivin Rabbit pAb (A1551) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Survivin Rabbit pAb (A1551)}

Immunohistochemistry - Survivin Rabbit pAb (A1551)

Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using Survivin Rabbit pAb (A1551) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Survivin Rabbit pAb (A1551)}

Immunohistochemistry - Survivin Rabbit pAb (A1551)

Immunohistochemistry analysis of paraffin-embedded human tonsil using Survivin Rabbit pAb (A1551) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Survivin Rabbit pAb (A1551)}

Immunohistochemistry - Survivin Rabbit pAb (A1551)

Immunohistochemistry analysis of paraffin-embedded mouse fetal liver using Survivin Rabbit pAb (A1551) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A1551 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on BIRC5. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to BIRC5. (Distance between topics and target gene indicate popularity.) BIRC5

* Data provided by citexs.com, for reference only.

Publishing research using A1551? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order