Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Smad7 Rabbit pAb (A12343)

Publications (5) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Smad7 Rabbit pAb (A12343)

Western blot analysis of extracts of various cell lines, using Smad7 antibody (A12343) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - Smad7 Rabbit pAb (A12343)

Immunofluorescence analysis of A-549 cells using Smad7 Rabbit pAb (A12343) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Smad7 Rabbit pAb (A12343)

Immunofluorescence analysis of HeLa cells using Smad7 Rabbit pAb (A12343) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Smad7 Rabbit pAb (A12343)

Immunofluorescence analysis of NIH/3T3 cells using Smad7 Rabbit pAb (A12343) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Smad7 Rabbit pAb
Catalog No. A12343
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a nuclear protein that binds the E3 ubiquitin ligase SMURF2. Upon binding, this complex translocates to the cytoplasm, where it interacts with TGF-beta receptor type-1 (TGFBR1), leading to the degradation of both the encoded protein and TGFBR1. Expression of this gene is induced by TGFBR1. Variations in this gene are a cause of susceptibility to colorectal cancer type 3 (CRCS3). Several transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 220-420 of human Smad7 (NP_005895.1).
Sequence KPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQLNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKVFPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLE
Gene ID 4092
Swiss prot O15105
Synonyms CRCS3; MADH7; MADH8; Smad7
Calculated MW 46kDa
Observed MW 50kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples ECV-304, A-549, Mouse brain, Rat brain
Cellular location Cytoplasm, Nucleus
Customer validation

WB (Homo sapiens, Mus musculus)

IHC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Smad7 Rabbit pAb images

ABclonal:Western blot - Smad7 Rabbit pAb (A12343)}

Western blot - Smad7 Rabbit pAb (A12343)

Western blot analysis of extracts of various cell lines, using Smad7 antibody (A12343) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunofluorescence - Smad7 Rabbit pAb (A12343)}

Immunofluorescence - Smad7 Rabbit pAb (A12343)

Immunofluorescence analysis of A-549 cells using Smad7 Rabbit pAb (A12343) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Smad7 Rabbit pAb (A12343)}

Immunofluorescence - Smad7 Rabbit pAb (A12343)

Immunofluorescence analysis of HeLa cells using Smad7 Rabbit pAb (A12343) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Smad7 Rabbit pAb (A12343)}

Immunofluorescence - Smad7 Rabbit pAb (A12343)

Immunofluorescence analysis of NIH/3T3 cells using Smad7 Rabbit pAb (A12343) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A12343 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SMAD7. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SMAD7. (Distance between topics and target gene indicate popularity.) SMAD7

* Data provided by citexs.com, for reference only.

Publishing research using A12343? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order