Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Smad2 Rabbit pAb (A11498)

Publications (7) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Smad2 Rabbit pAb (A11498)

Western blot analysis of extracts of various cell lines, using Smad2 antibody (A11498) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Western blot - Smad2 Rabbit pAb (A11498)

Western blot analysis of extracts of various cell lines, using Smad2 antibody (A11498) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - Smad2 Rabbit pAb (A11498)

Immunohistochemistry analysis of paraffin-embedded human urothelial carcinoma using Smad2 Rabbit pAb (A11498) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name Smad2 Rabbit pAb
Catalog No. A11498
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signal of the transforming growth factor (TGF)-beta, and thus regulates multiple cellular processes, such as cell proliferation, apoptosis, and differentiation. This protein is recruited to the TGF-beta receptors through its interaction with the SMAD anchor for receptor activation (SARA) protein. In response to TGF-beta signal, this protein is phosphorylated by the TGF-beta receptors. The phosphorylation induces the dissociation of this protein with SARA and the association with the family member SMAD4. The association with SMAD4 is important for the translocation of this protein into the nucleus, where it binds to target promoters and forms a transcription repressor complex with other cofactors. This protein can also be phosphorylated by activin type 1 receptor kinase, and mediates the signal from the activin. Alternatively spliced transcript variants have been observed for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Smad2 (NP_005892.1).
Sequence MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTG
Gene ID 4087
Swiss prot Q15796
Synonyms JV18; LDS6; CHTD8; MADH2; MADR2; JV18-1; hMAD-2; hSMAD2; Smad2
Calculated MW 52kDa
Observed MW 60kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HT-1080, C2C12, C6, Rat testis
Cellular location Cytoplasm, Nucleus
Customer validation

WB (Rattus norvegicus, Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Smad2 Rabbit pAb images

ABclonal:Western blot - Smad2 Rabbit pAb (A11498)}

Western blot - Smad2 Rabbit pAb (A11498)

Western blot analysis of extracts of various cell lines, using Smad2 antibody (A11498) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Western blot - Smad2 Rabbit pAb (A11498)}

Western blot - Smad2 Rabbit pAb (A11498)

Western blot analysis of extracts of various cell lines, using Smad2 antibody (A11498) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunohistochemistry - Smad2 Rabbit pAb (A11498)}

Immunohistochemistry - Smad2 Rabbit pAb (A11498)

Immunohistochemistry analysis of paraffin-embedded human urothelial carcinoma using Smad2 Rabbit pAb (A11498) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A11498 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SMAD2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SMAD2. (Distance between topics and target gene indicate popularity.) SMAD2

* Data provided by citexs.com, for reference only.

Publishing research using A11498? Please let us know so that we can cite the reference in this datasheet.

Antibodies (11)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order