Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

SUPT4H1 Rabbit pAb (A7933)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - SUPT4H1 Rabbit pAb (A7933)

Western blot analysis of extracts of various cell lines, using SUPT4H1 Antibody (A7933) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

You may also interested in:

Overview

Product name	SUPT4H1 Rabbit pAb
Catalog No.	A7933
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes the small subunit of DRB (5, 6-dichloro-1-beta-d-ribofuranosylbenzimidazole) sensitivity-inducing factor (DSIF) complex, which regulates mRNA processing and transcription elongation by RNA polymerase II. The encoded protein is localized to the nucleus and interacts with the large subunit (SUPT5H) to form the DSIF complex. Related pseudogenes have been identified on chromosomes 2 and 12. Alternatively spliced transcript variants have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human SUPT4H1 (NP_003159.1).
Sequence	MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT
Gene ID	6827
Swiss prot	P63272
Synonyms	SPT4; SPT4H; SUPT4H; Supt4a
Calculated MW	13kDa
Observed MW	14kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key	Western blotting
Positive samples	MCF7, B cells
Cellular location	Nucleus
Customer validation	WB(Homo sapiens)

SUPT4H1 Rabbit pAb images

Western blot - SUPT4H1 Rabbit pAb (A7933)

Product Protocols

Inquire About This Product

Submit your question about A7933 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SUPT4H1. (Numbers indicate number of published articles where both targets appear.)

◀1/▶

Related Research Area

Based on existing publications, the following research topics are related to SUPT4H1. (Distance between topics and target gene indicate popularity.) SUPT4H1

* Data provided by citexs.com, for reference only.