Tested applications:WBIHCIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPReactivity:Human
Product name | SUPT4H1 Rabbit pAb |
---|---|
Catalog No. | A7933 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human SUPT4H1 (NP_003159.1). |
---|---|
Sequence | MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT |
Gene ID | 6827 |
Swiss prot | P63272 |
Synonyms | SUPT4H1; SPT4; SPT4H; SUPT4H; Supt4a |
Calculated MW | 13kDa |
Observed MW | 14kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHCIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIP |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | MCF7, B cells |
Cellular location | Nucleus |
Customer validation | WB(Homo sapiens) |
Submit your question about A7933 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A7933? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.