Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

SUCLA2 Rabbit pAb (A10040)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - SUCLA2 Rabbit pAb (A10040)

Western blot analysis of extracts of various cell lines, using SUCLA2 antibody (A10040) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - SUCLA2 Rabbit pAb (A10040)

Immunofluorescence analysis of L929 using SUCLA2 antibody (A10040) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - SUCLA2 Rabbit pAb (A10040)

Immunofluorescence analysis of U2OS using SUCLA2 antibody (A10040) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name SUCLA2 Rabbit pAb
Catalog No. A10040
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Succinyl-CoA synthetase (SCS) is a mitochondrial matrix enzyme that acts as a heterodimer, being composed of an invariant alpha subunit and a substrate-specific beta subunit. The protein encoded by this gene is an ATP-specific SCS beta subunit that dimerizes with the SCS alpha subunit to form SCS-A, an essential component of the tricarboxylic acid cycle. SCS-A hydrolyzes ATP to convert succinate to succinyl-CoA. Defects in this gene are a cause of myopathic mitochondrial DNA depletion syndrome. A pseudogene of this gene has been found on chromosome 6.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SUCLA2 (NP_003841.1).
Sequence MAASMFYGRLVAVATLRNHRPRTAQRAAAQVLGSSGLFNNHGLQVQQQQQRNLSLHEYMSMELLQEAGVSVPKGYVAKSPDEAYAIAKKLGSKDVVIKAQVLAGGRGKGTFESGLKGGVKIVFSPEEAKAVSSQMIGKKLFTKQTGEKGRICNQVLVCERKYPRREYYFAITMERSFQGP
Gene ID 8803
Swiss prot Q9P2R7
Synonyms A-SCS; A-BETA; MTDPS5; LINC00444; SCS-betaA; SUCLA2
Calculated MW 50kDa
Observed MW 50kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples 293T, SW480, HeLa, Mouse heart, Mouse liver, Mouse brain, Rat liver
Cellular location Mitochondrion

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

SUCLA2 Rabbit pAb images

ABclonal:Western blot - SUCLA2 Rabbit pAb (A10040)}

Western blot - SUCLA2 Rabbit pAb (A10040)

Western blot analysis of extracts of various cell lines, using SUCLA2 antibody (A10040) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunofluorescence - SUCLA2 Rabbit pAb (A10040)}

Immunofluorescence - SUCLA2 Rabbit pAb (A10040)

Immunofluorescence analysis of L929 using SUCLA2 antibody (A10040) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - SUCLA2 Rabbit pAb (A10040)}

Immunofluorescence - SUCLA2 Rabbit pAb (A10040)

Immunofluorescence analysis of U2OS using SUCLA2 antibody (A10040) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A10040 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SUCLA2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SUCLA2. (Distance between topics and target gene indicate popularity.) SUCLA2

* Data provided by citexs.com, for reference only.

Publishing research using A10040? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order