Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

SUB1 Rabbit pAb (A7070)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - SUB1 Rabbit pAb (A7070)

Western blot analysis of various lysates using SUB1 Rabbit pAb (A7070) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - SUB1 Rabbit pAb (A7070)

Immunofluorescence analysis of A549 cells using SUB1 Rabbit pAb (A7070).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.

ABclonal:Immunoprecipitation - SUB1 Rabbit pAb (A7070)

Immunoprecipitation analysis of 150 μg extracts of HL60 cells using 3 μg SUB1 antibody (A7070). Western blot was performed from the immunoprecipitate using SUB1 antibody (A7070) at a dilution of 1:500.

You may also interested in:

Overview

Product name SUB1 Rabbit pAb
Catalog No. A7070
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables identical protein binding activity; single-stranded DNA binding activity; and transcription coactivator activity. Involved in negative regulation of DNA metabolic process and regulation of transcription by RNA polymerase II. Located in nucleolus and nucleoplasm. Part of transcription regulator complex.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human SUB1 (NP_006704.3).
Sequence MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL
Gene ID 10923
Swiss prot P53999
Synonyms P15; PC4; p14; SUB1
Calculated MW 14kDa
Observed MW 17kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:100
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    Immunoprecipitation    
Positive samples HL-60, BT-474, SW620, Jurkat, Mouse brain
Cellular location Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

SUB1 Rabbit pAb images

ABclonal:Western blot - SUB1 Rabbit pAb (A7070)}

Western blot - SUB1 Rabbit pAb (A7070)

Western blot analysis of various lysates using SUB1 Rabbit pAb (A7070) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunofluorescence - SUB1 Rabbit pAb (A7070)}

Immunofluorescence - SUB1 Rabbit pAb (A7070)

Immunofluorescence analysis of A549 cells using SUB1 Rabbit pAb (A7070).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.
ABclonal:Immunoprecipitation - SUB1 Rabbit pAb (A7070)}

Immunoprecipitation - SUB1 Rabbit pAb (A7070)

Immunoprecipitation analysis of 150 μg extracts of HL60 cells using 3 μg SUB1 antibody (A7070). Western blot was performed from the immunoprecipitate using SUB1 antibody (A7070) at a dilution of 1:500.

Inquire About This Product

Submit your question about A7070 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SUB1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SUB1. (Distance between topics and target gene indicate popularity.) SUB1

* Data provided by citexs.com, for reference only.

Publishing research using A7070? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order