Tested applications:WBIHCIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPReactivity:Human, Mouse, Rat
Product name | STAU2 Rabbit pAb |
---|---|
Catalog No. | A3413 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human STAU2 (NP_001157852.1). |
---|---|
Sequence | PEYGQGMNPISRLAQIQQAKKEKEPDYVLLSERGMPRRREFVMQVKVGNEVATGTGPNKKIAKKNAAEAMLLQLGYKASTNLQDQLEKTGENKGWSGPKPG |
Gene ID | 27067 |
Swiss prot | Q9NUL3 |
Synonyms | STAU2; 39K2; 39K3 |
Calculated MW | 11kDa/34kDa/43kDa/52kDa/55kDa/59kDa/62kDa |
Observed MW | 52kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIP |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. May contain BSA. If BSA-free batch required, please contact us. |
Application key | Western blotting |
Positive samples | Mouse heart, Mouse kidney, Rat heart, Rat brain |
Cellular location | Cytoplasm, Endoplasmic reticulum, Nucleus, nucleolus |
Submit your question about A3413 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on STAU2. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to STAU2. (Distance between topics and target gene indicate popularity.) STAU2
* Data provided by citexs.com, for reference only.
Publishing research using A3413? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.