Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

STAU2 Rabbit pAb (A14117)

Tested applications:WB IHC IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIPReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using STAU2 antibody (A14117) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - STAU2 Rabbit pAb (A14117)

Immunofluorescence analysis of U2OS cells using STAU2 antibody (A14117) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	STAU2 Rabbit pAb
Catalog No.	A14117
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Staufen homolog 2 is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. Staufen homolog 2 shares 48.5% and 59.9% similarity with drosophila and human staufen, respectively. The exact function of Staufen homolog 2 is not known, but since it contains 3 copies of conserved dsRNA binding domain, it could be involved in double-stranded RNA binding events. Several transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 300-400 of human STAU2 (NP_001157852.1).
Sequence	PEYGQGMNPISRLAQIQQAKKEKEPDYVLLSERGMPRRREFVMQVKVGNEVATGTGPNKKIAKKNAAEAMLLQLGYKASTNLQDQLEKTGENKGWSGPKPG
Gene ID	27067
Swiss prot	Q9NUL3
Synonyms	STAU2; 39K2; 39K3
Calculated MW	11kDa/34kDa/43kDa/52kDa/55kDa/59kDa/62kDa
Observed MW	49kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. May contain BSA. If BSA-free batch required, please contact us.
Application key	Western blotting
Positive samples	HeLa, A-549, Mouse heart, Rat heart
Cellular location	Cytoplasm, Endoplasmic reticulum, Nucleus, nucleolus

Research Area

STAU2 Rabbit pAb images

Western blot - STAU2 Rabbit pAb (A14117)

Immunofluorescence - STAU2 Rabbit pAb (A14117)

Immunofluorescence analysis of U2OS cells using STAU2 antibody (A14117) at dilution of 1:100. Blue: DAPI for nuclear staining.

Product Protocols

Inquire About This Product

Submit your question about A14117 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on STAU2. (Numbers indicate number of published articles where both targets appear.)

◀1/▶

Related Research Area

Based on existing publications, the following research topics are related to STAU2. (Distance between topics and target gene indicate popularity.) STAU2

* Data provided by citexs.com, for reference only.