Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

STAT3 Rabbit pAb (A1192)

Reviews (3) Publications (62) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - STAT3 Rabbit pAb (A1192)

Western blot analysis of various lysates, using STAT3 Rabbit pAb (A1192) at 1:2500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - STAT3 Rabbit pAb (A1192)

Immunohistochemistry analysis of STAT3 in paraffin-embedded mouse brain using STAT3 Rabbit pAb (A1192) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - STAT3 Rabbit pAb (A1192)

Immunohistochemistry analysis of STAT3 in paraffin-embedded mouse kidney using STAT3 Rabbit pAb (A1192) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - STAT3 Rabbit pAb (A1192)

Immunohistochemistry analysis of STAT3 in paraffin-embedded rat heart using STAT3 Rabbit pAb (A1192) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - STAT3 Rabbit pAb (A1192)

Immunohistochemistry analysis of STAT3 in paraffin-embedded rat kidney using STAT3 Rabbit pAb (A1192) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - STAT3 Rabbit pAb (A1192)

Immunofluorescence analysis of NIH/3T3 cells using STAT3 Rabbit pAb (A1192) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - STAT3 Rabbit pAb (A1192)

Immunofluorescence analysis of PC-12 cells using STAT3 Rabbit pAb (A1192) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - STAT3 Rabbit pAb (A1192)

Immunofluorescence analysis of U2OS cells using STAT3 Rabbit pAb (A1192) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - STAT3 Rabbit pAb (A1192)

Immunofluorescence analysis of NIH/3T3 cells using STAT3 Rabbit pAb (A1192) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - STAT3 Rabbit pAb (A1192)

Immunofluorescence analysis of PC-12 cells using STAT3 Rabbit pAb (A1192) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - STAT3 Rabbit pAb (A1192)

Immunofluorescence analysis of U2OS cells using STAT3 Rabbit pAb (A1192) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for STAT3 Rabbit pAb(A1192)
Review
ABclonal: review for STAT3 Rabbit pAb(A1192)
Review
ABclonal: review for STAT3 Rabbit pAb(A1192)

You may also interested in:

Overview

Product name STAT3 Rabbit pAb
Catalog No. A1192
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. This gene also plays a role in regulating host response to viral and bacterial infections. Mutations in this gene are associated with infantile-onset multisystem autoimmune disease and hyper-immunoglobulin E syndrome.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 600-700 of human STAT3 (NP_003141.2).
Sequence TKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPG
Gene ID 6774
Swiss prot P40763
Synonyms APRF; HIES; ADMIO; ADMIO1; STAT3
Calculated MW 88kDa
Observed MW 86kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples A-549, HeLa
Cellular location Cytoplasm, Nucleus
Customer validation

WB (Human breast cancer, PK15Homo sapiens, Mus musculus, Homo sapiens, Rattus norvegicus, Sus scrofa)

IHC (Human breast cancerGallus gallus, Homo sapiens, Mus musculus)

IF (Homo sapiens, Rattus norvegicus, Mus musculus)

Co-IP (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

STAT3 Rabbit pAb images

ABclonal:Western blot - STAT3 Rabbit pAb (A1192)}

Western blot - STAT3 Rabbit pAb (A1192)

Western blot analysis of various lysates, using STAT3 Rabbit pAb (A1192) at 1:2500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Immunohistochemistry - STAT3 Rabbit pAb (A1192)}

Immunohistochemistry - STAT3 Rabbit pAb (A1192)

Immunohistochemistry analysis of STAT3 in paraffin-embedded mouse brain using STAT3 Rabbit pAb (A1192) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - STAT3 Rabbit pAb (A1192)}

Immunohistochemistry - STAT3 Rabbit pAb (A1192)

Immunohistochemistry analysis of STAT3 in paraffin-embedded mouse kidney using STAT3 Rabbit pAb (A1192) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - STAT3 Rabbit pAb (A1192)}

Immunohistochemistry - STAT3 Rabbit pAb (A1192)

Immunohistochemistry analysis of STAT3 in paraffin-embedded rat heart using STAT3 Rabbit pAb (A1192) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - STAT3 Rabbit pAb (A1192)}

Immunohistochemistry - STAT3 Rabbit pAb (A1192)

Immunohistochemistry analysis of STAT3 in paraffin-embedded rat kidney using STAT3 Rabbit pAb (A1192) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - STAT3 Rabbit pAb (A1192)}

Immunofluorescence - STAT3 Rabbit pAb (A1192)

Immunofluorescence analysis of NIH/3T3 cells using STAT3 Rabbit pAb (A1192) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - STAT3 Rabbit pAb (A1192)}

Immunofluorescence - STAT3 Rabbit pAb (A1192)

Immunofluorescence analysis of PC-12 cells using STAT3 Rabbit pAb (A1192) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - STAT3 Rabbit pAb (A1192)}

Immunofluorescence - STAT3 Rabbit pAb (A1192)

Immunofluorescence analysis of U2OS cells using STAT3 Rabbit pAb (A1192) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - STAT3 Rabbit pAb (A1192)}

Immunofluorescence - STAT3 Rabbit pAb (A1192)

Immunofluorescence analysis of NIH/3T3 cells using STAT3 Rabbit pAb (A1192) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - STAT3 Rabbit pAb (A1192)}

Immunofluorescence - STAT3 Rabbit pAb (A1192)

Immunofluorescence analysis of PC-12 cells using STAT3 Rabbit pAb (A1192) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - STAT3 Rabbit pAb (A1192)}

Immunofluorescence - STAT3 Rabbit pAb (A1192)

Immunofluorescence analysis of U2OS cells using STAT3 Rabbit pAb (A1192) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A1192

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1192 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on STAT3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to STAT3. (Distance between topics and target gene indicate popularity.) STAT3

* Data provided by citexs.com, for reference only.

Publishing research using A1192? Please let us know so that we can cite the reference in this datasheet.

Antibodies (11)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order