Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

SQSTM1/p62 Rabbit pAb (A11247)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - SQSTM1/p62 Rabbit pAb (A11247)

Western blot analysis of lysates from HeLa cells, using SQSTM1/p62 Rabbit pAb (A11247) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

You may also interested in:

Overview

Product name SQSTM1/p62 Rabbit pAb
Catalog No. A11247
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a multifunctional protein that binds ubiquitin and regulates activation of the nuclear factor kappa-B (NF-kB) signaling pathway. The protein functions as a scaffolding/adaptor protein in concert with TNF receptor-associated factor 6 to mediate activation of NF-kB in response to upstream signals. Alternatively spliced transcript variants encoding either the same or different isoforms have been identified for this gene. Mutations in this gene result in sporadic and familial Paget disease of bone.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 341-440 of human SQSTM1/p62 (NP_003891.1).
Sequence LSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL
Gene ID 8878
Swiss prot Q13501
Synonyms p60; p62; A170; DMRV; OSIL; PDB3; ZIP3; p62B; NADGP; FTDALS3; SQSTM1/p62
Calculated MW 48kDa
Observed MW 62kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa
Cellular location Cytoplasm, Cytoplasmic vesicle, Endoplasmic reticulum, Late endosome, Lysosome, Nucleus, P-body, autophagosome
Customer validation

WB (Mus musculus, Gibel carp)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

SQSTM1/p62 Rabbit pAb images

ABclonal:Western blot - SQSTM1/p62 Rabbit pAb (A11247)}

Western blot - SQSTM1/p62 Rabbit pAb (A11247)

Western blot analysis of lysates from HeLa cells, using SQSTM1/p62 Rabbit pAb (A11247) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Inquire About This Product

Submit your question about A11247 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SQSTM1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SQSTM1. (Distance between topics and target gene indicate popularity.) SQSTM1

* Data provided by citexs.com, for reference only.

Publishing research using A11247? Please let us know so that we can cite the reference in this datasheet.

Antibodies (8)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order