Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

SP1 Rabbit pAb (A14662)

Publications (8) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - SP1 Rabbit pAb (A14662)

Western blot analysis of Mouse heart, using SP1 antibody (A14662) at 1:600 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - SP1 Rabbit pAb (A14662)

Immunohistochemistry analysis of paraffin-embedded rat liver using SP1 Rabbit pAb (A14662) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - SP1 Rabbit pAb (A14662)

Immunohistochemistry analysis of paraffin-embedded rat spleen using SP1 Rabbit pAb (A14662) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - SP1 Rabbit pAb (A14662)

Immunohistochemistry analysis of paraffin-embedded mouse testis using SP1 Rabbit pAb (A14662) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - SP1 Rabbit pAb (A14662)

Immunofluorescence analysis of NIH/3T3 cells using SP1 Rabbit pAb (A14662) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name SP1 Rabbit pAb
Catalog No. A14662
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a zinc finger transcription factor that binds to GC-rich motifs of many promoters. The encoded protein is involved in many cellular processes, including cell differentiation, cell growth, apoptosis, immune responses, response to DNA damage, and chromatin remodeling. Post-translational modifications such as phosphorylation, acetylation, glycosylation, and proteolytic processing significantly affect the activity of this protein, which can be an activator or a repressor. Three transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 420-620 of human SP1 (NP_612482.2).
Sequence LSGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSGDP
Gene ID 6667
Swiss prot P08047
Synonyms SP1
Calculated MW 81kDa
Observed MW 90kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Mouse heart
Cellular location Cytoplasm, Nucleus
Customer validation

WB (Homo sapiens, Capra hircus, Sus scrofa, Rattus norvegicus)

ChIP (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

SP1 Rabbit pAb images

ABclonal:Western blot - SP1 Rabbit pAb (A14662)}

Western blot - SP1 Rabbit pAb (A14662)

Western blot analysis of Mouse heart, using SP1 antibody (A14662) at 1:600 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - SP1 Rabbit pAb (A14662)}

Immunohistochemistry - SP1 Rabbit pAb (A14662)

Immunohistochemistry analysis of paraffin-embedded rat liver using SP1 Rabbit pAb (A14662) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - SP1 Rabbit pAb (A14662)}

Immunohistochemistry - SP1 Rabbit pAb (A14662)

Immunohistochemistry analysis of paraffin-embedded rat spleen using SP1 Rabbit pAb (A14662) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - SP1 Rabbit pAb (A14662)}

Immunohistochemistry - SP1 Rabbit pAb (A14662)

Immunohistochemistry analysis of paraffin-embedded mouse testis using SP1 Rabbit pAb (A14662) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - SP1 Rabbit pAb (A14662)}

Immunofluorescence - SP1 Rabbit pAb (A14662)

Immunofluorescence analysis of NIH/3T3 cells using SP1 Rabbit pAb (A14662) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A14662 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SP1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SP1. (Distance between topics and target gene indicate popularity.) SP1

* Data provided by citexs.com, for reference only.

Publishing research using A14662? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order