Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

SOX2 Rabbit pAb (A6171)

Publications (3) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - SOX2 Rabbit pAb (A6171)

Western blot analysis of lysates from HeLa cells, using SOX2 Rabbit pAb (A6171).
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunohistochemistry - SOX2 Rabbit pAb (A6171)

Immunohistochemistry analysis of SOX2 in paraffin-embedded mouse embryos using SOX2 Rabbit pAb (A6171) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name SOX2 Rabbit pAb
Catalog No. A6171
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This intronless gene encodes a member of the SRY-related HMG-box (SOX) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The product of this gene is required for stem-cell maintenance in the central nervous system, and also regulates gene expression in the stomach. Mutations in this gene have been associated with optic nerve hypoplasia and with syndromic microphthalmia, a severe form of structural eye malformation. This gene lies within an intron of another gene called SOX2 overlapping transcript (SOX2OT).

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human SOX2 (NP_003097.1).
Sequence MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMA
Gene ID 6657
Swiss prot P48431
Synonyms ANOP3; MCOPS3; SOX2
Calculated MW 34kDa
Observed MW 36kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa
Cellular location Nucleus
Customer validation

WB (Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

SOX2 Rabbit pAb images

ABclonal:Western blot - SOX2 Rabbit pAb (A6171)}

Western blot - SOX2 Rabbit pAb (A6171)

Western blot analysis of lysates from HeLa cells, using SOX2 Rabbit pAb (A6171).
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
ABclonal:Immunohistochemistry - SOX2 Rabbit pAb (A6171)}

Immunohistochemistry - SOX2 Rabbit pAb (A6171)

Immunohistochemistry analysis of SOX2 in paraffin-embedded mouse embryos using SOX2 Rabbit pAb (A6171) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A6171 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SOX2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SOX2. (Distance between topics and target gene indicate popularity.) SOX2

* Data provided by citexs.com, for reference only.

Publishing research using A6171? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order