Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

SOCS3 Rabbit mAb (A21981)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - SOCS3 Rabbit mAb (A21981)

Western blot analysis of extracts of various cell lines, using SOCS3 antibody (A21981) at1:2000 dilution.Raw264.7 cells were treated by LPS (1 μg/ml) at 37℃ for 8 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Western blot - SOCS3 Rabbit mAb (A21981)

Western blot analysis of 293T-SOCS3-Flag, using SOCS3 Rabbit mAb (A21981) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

You may also interested in:

Overview

Product name SOCS3 Rabbit mAb
Catalog No. A21981
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC53312

Background

This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene is induced by various cytokines, including IL6, IL10, and interferon (IFN)-gamma. The protein encoded by this gene can bind to JAK2 kinase, and inhibit the activity of JAK2 kinase. Studies of the mouse counterpart of this gene suggested the roles of this gene in the negative regulation of fetal liver hematopoiesis, and placental development.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 126-225 of human SOCS3 (NP_003946.3).
Sequence HYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Gene ID 9021
Swiss prot O14543
Synonyms CIS3; SSI3; ATOD4; Cish3; SSI-3; SOCS-3; SOCS3
Calculated MW 25kDa
Observed MW 28kDa

Applications

Reactivity Human, Mouse
Tested applications Testing results
WB HumanMouse
Recommended dilution
  • WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples RAW 264.7+LPS, 293T-SOCS3-Flag
Cellular location Cytosol

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

SOCS3 Rabbit mAb images

ABclonal:Western blot - SOCS3 Rabbit mAb (A21981)}

Western blot - SOCS3 Rabbit mAb (A21981)

Western blot analysis of extracts of various cell lines, using SOCS3 antibody (A21981) at1:2000 dilution.Raw264.7 cells were treated by LPS (1 μg/ml) at 37℃ for 8 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
ABclonal:Western blot - SOCS3 Rabbit mAb (A21981)}

Western blot - SOCS3 Rabbit mAb (A21981)

Western blot analysis of 293T-SOCS3-Flag, using SOCS3 Rabbit mAb (A21981) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Inquire About This Product

Submit your question about A21981 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SOCS3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SOCS3. (Distance between topics and target gene indicate popularity.) SOCS3

* Data provided by citexs.com, for reference only.

Publishing research using A21981? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order