Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse
Product name | SOCS3 Rabbit mAb |
---|---|
Catalog No. | A21981 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC53312 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 126-225 of human SOCS3 (NP_003946.3). |
---|---|
Sequence | HYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL |
Gene ID | 9021 |
Swiss prot | O14543 |
Synonyms | CIS3; SSI3; ATOD4; Cish3; SSI-3; SOCS-3; SOCS3 |
Calculated MW | 25kDa |
Observed MW | 28kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | Testing results |
WB | |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | RAW 264.7+LPS, 293T-SOCS3-Flag |
Cellular location | Cytosol |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A21981 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on SOCS3. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to SOCS3. (Distance between topics and target gene indicate popularity.) SOCS3
* Data provided by citexs.com, for reference only.
Publishing research using A21981? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.