Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

SNRPB Rabbit pAb (A2009)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - SNRPB Rabbit pAb (A2009)

Western blot analysis of various lysates using SNRPB Rabbit pAb (A2009) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunohistochemistry - SNRPB Rabbit pAb (A2009)

Immunohistochemistry analysis of SNRPB in paraffin-embedded rat spleen using SNRPB Rabbit pAb (A2009) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - SNRPB Rabbit pAb (A2009)

Immunohistochemistry analysis of SNRPB in paraffin-embedded human colon carcinoma using SNRPB Rabbit pAb (A2009) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - SNRPB Rabbit pAb (A2009)

Immunohistochemistry analysis of SNRPB in paraffin-embedded mouse spleen using SNRPB Rabbit pAb (A2009) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name SNRPB Rabbit pAb
Catalog No. A2009
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a role in pre-mRNA splicing or snRNP structure. Autoantibodies from patients with systemic lupus erythematosus frequently recognize epitopes on the encoded protein. Two transcript variants encoding different isoforms (B and B') have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SNRPB (NP_003082.1).
Sequence MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGA
Gene ID 6628
Swiss prot P14678
Synonyms COD; CCMS; SNRPB1; SmB/B'; Sm-B/B'; snRNP-B; SmB/SmB'; SNRPB
Calculated MW 25kDa
Observed MW 30kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HeLa, HT-29, Jurkat, HepG2, Mouse brain
Cellular location Cytoplasm, Nucleus, cytosol

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

SNRPB Rabbit pAb images

ABclonal:Western blot - SNRPB Rabbit pAb (A2009)}

Western blot - SNRPB Rabbit pAb (A2009)

Western blot analysis of various lysates using SNRPB Rabbit pAb (A2009) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
ABclonal:Immunohistochemistry - SNRPB Rabbit pAb (A2009)}

Immunohistochemistry - SNRPB Rabbit pAb (A2009)

Immunohistochemistry analysis of SNRPB in paraffin-embedded rat spleen using SNRPB Rabbit pAb (A2009) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - SNRPB Rabbit pAb (A2009)}

Immunohistochemistry - SNRPB Rabbit pAb (A2009)

Immunohistochemistry analysis of SNRPB in paraffin-embedded human colon carcinoma using SNRPB Rabbit pAb (A2009) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - SNRPB Rabbit pAb (A2009)}

Immunohistochemistry - SNRPB Rabbit pAb (A2009)

Immunohistochemistry analysis of SNRPB in paraffin-embedded mouse spleen using SNRPB Rabbit pAb (A2009) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A2009 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SNRPB. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SNRPB. (Distance between topics and target gene indicate popularity.) SNRPB

* Data provided by citexs.com, for reference only.

Publishing research using A2009? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order