Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

SGK1 Rabbit pAb (A1025)

Review (1) Publications (6) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - SGK1 Rabbit pAb (A1025)

Western blot analysis of various lysates, using SGK1 Rabbit pAb (A1025) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - SGK1 Rabbit pAb (A1025)

Immunohistochemistry analysis of SGK1 in paraffin-embedded mouse kidney using SGK1 Rabbit pAb (A1025) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - SGK1 Rabbit pAb (A1025)

Immunofluorescence analysis of L929 cells using SGK1 Rabbit pAb (A1025) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for SGK1 Rabbit pAb(A1025)

You may also interested in:

Overview

Product name SGK1 Rabbit pAb
Catalog No. A1025
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell survival, neuronal excitability, and renal sodium excretion. High levels of expression of this gene may contribute to conditions such as hypertension and diabetic nephropathy. Several alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 172-431 of human SGK1 (NP_005618.2).
Sequence LYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLGFSYAPPTDSFL
Gene ID 6446
Swiss prot O00141
Synonyms SGK; SGK1
Calculated MW 49kDa
Observed MW 45-60kDa

Applications

Reactivity Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples SK-MEL-28, Mouse brain, Rat lung
Cellular location Cell membrane, Cytoplasm, Endoplasmic reticulum membrane, Mitochondrion, Nucleus
Customer validation

WB (Murine tissueHomo sapiens, Rattus norvegicus, Homo sapiens, Mus musculus)

IHC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

SGK1 Rabbit pAb images

ABclonal:Western blot - SGK1 Rabbit pAb (A1025)}

Western blot - SGK1 Rabbit pAb (A1025)

Western blot analysis of various lysates, using SGK1 Rabbit pAb (A1025) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - SGK1 Rabbit pAb (A1025)}

Immunohistochemistry - SGK1 Rabbit pAb (A1025)

Immunohistochemistry analysis of SGK1 in paraffin-embedded mouse kidney using SGK1 Rabbit pAb (A1025) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - SGK1 Rabbit pAb (A1025)}

Immunofluorescence - SGK1 Rabbit pAb (A1025)

Immunofluorescence analysis of L929 cells using SGK1 Rabbit pAb (A1025) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A1025

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1025 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SGK1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SGK1. (Distance between topics and target gene indicate popularity.) SGK1

* Data provided by citexs.com, for reference only.

Publishing research using A1025? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order