Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

SFPQ Rabbit pAb (A0958)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - SFPQ Rabbit pAb (A0958)

Western blot analysis of various lysates using SFPQ Rabbit pAb (A0958) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - SFPQ Rabbit pAb (A0958)

Immunohistochemistry analysis of SFPQ in paraffin-embedded human esophageal using SFPQ Rabbit pAb (A0958) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - SFPQ Rabbit pAb (A0958)

Immunohistochemistry analysis of SFPQ in paraffin-embedded human placenta using SFPQ Rabbit pAb (A0958) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - SFPQ Rabbit pAb (A0958)

Immunofluorescence analysis of HeLa cells using SFPQ Rabbit pAb (A0958) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - SFPQ Rabbit pAb (A0958)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg SFPQ antibody (A0958). Western blot was performed from the immunoprecipitate using SFPQ antibody (A0958) at a dilution of 1:1000.

You may also interested in:

Overview

Product name SFPQ Rabbit pAb
Catalog No. A0958
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables DNA binding activity; histone deacetylase binding activity; and protein homodimerization activity. Involved in several processes, including alternative mRNA splicing, via spliceosome; positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway; and regulation of transcription by RNA polymerase II. Acts upstream of or within double-strand break repair via homologous recombination. Located in chromatin; nuclear matrix; and paraspeckles.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 578-707 of human SFPQ (NP_005057.1).
Sequence MMIRQREMEEQMRRQREESYSRMGYMDPRERDMRMGGGGAMNMGDPYGSGGQKFPPLGGGGGIGYEANPGVPPATMSGSMMGSDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNKKPRF
Gene ID 6421
Swiss prot P23246
Synonyms PSF; POMP100; PPP1R140; SFPQ
Calculated MW 76kDa
Observed MW 115kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:100
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples OVCAR3, HeLa, Jurkat, HepG2, Mouse brain, Mouse liver, Mouse spleen, Rat brain
Cellular location Cytoplasm, Nucleus matrix
Customer validation

WB (Homo sapiens)

RIP (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

SFPQ Rabbit pAb images

ABclonal:Western blot - SFPQ Rabbit pAb (A0958)}

Western blot - SFPQ Rabbit pAb (A0958)

Western blot analysis of various lysates using SFPQ Rabbit pAb (A0958) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunohistochemistry - SFPQ Rabbit pAb (A0958)}

Immunohistochemistry - SFPQ Rabbit pAb (A0958)

Immunohistochemistry analysis of SFPQ in paraffin-embedded human esophageal using SFPQ Rabbit pAb (A0958) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - SFPQ Rabbit pAb (A0958)}

Immunohistochemistry - SFPQ Rabbit pAb (A0958)

Immunohistochemistry analysis of SFPQ in paraffin-embedded human placenta using SFPQ Rabbit pAb (A0958) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - SFPQ Rabbit pAb (A0958)}

Immunofluorescence - SFPQ Rabbit pAb (A0958)

Immunofluorescence analysis of HeLa cells using SFPQ Rabbit pAb (A0958) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - SFPQ Rabbit pAb (A0958)}

Immunoprecipitation - SFPQ Rabbit pAb (A0958)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg SFPQ antibody (A0958). Western blot was performed from the immunoprecipitate using SFPQ antibody (A0958) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A0958 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SFPQ. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SFPQ. (Distance between topics and target gene indicate popularity.) SFPQ

* Data provided by citexs.com, for reference only.

Publishing research using A0958? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order