Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

SECISBP2 Rabbit pAb (A6736)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - SECISBP2 Rabbit pAb (A6736)

Western blot analysis of extracts of various cell lines, using SECISBP2 antibody (A6736) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - SECISBP2 Rabbit pAb (A6736)

Immunohistochemistry analysis of paraffin-embedded human liver damage using SECISBP2 antibody (A6736) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - SECISBP2 Rabbit pAb (A6736)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using SECISBP2 antibody (A6736) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - SECISBP2 Rabbit pAb (A6736)

Immunofluorescence analysis of HeLa cells using SECISBP2 Rabbit pAb (A6736) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - SECISBP2 Rabbit pAb (A6736)

Immunofluorescence analysis of NIH/3T3 cells using SECISBP2 Rabbit pAb (A6736) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - SECISBP2 Rabbit pAb (A6736)

Immunofluorescence analysis of U2OS cells using SECISBP2 Rabbit pAb (A6736) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name SECISBP2 Rabbit pAb
Catalog No. A6736
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is one of the essential components of the machinery involved in co-translational insertion of selenocysteine (Sec) into selenoproteins. Sec is encoded by the UGA codon, which normally signals translation termination. The recoding of UGA as Sec codon requires a Sec insertion sequence (SECIS) element; present in the 3' untranslated regions of eukaryotic selenoprotein mRNAs. This protein specifically binds to the SECIS element, which is stimulated by a Sec-specific translation elongation factor. Mutations in this gene have been associated with reduction in enzymatic activity of type II iodothyronine deiodinase (a selenoprotein) and abnormal thyroid hormone metabolism. Alternatively spliced transcript variants have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 585-854 of human SECISBP2 (NP_076982.3).
Sequence DELISTPSVEDKSEEPPGTELQRDTEASHLAPNHTTFPKIHSRRFRDYCSQMLSKEVDACVTDLLKELVRFQDRMYQKDPVKAKTKRRLVLGLREVLKHLKLKKLKCVIISPNCEKIQSKGGLDDTLHTIIDYACEQNIPFVFALNRKALGRSLNKAVPVSVVGIFSYDGAQDQFHKMVELTVAARQAYKTMLENVQQELVGEPRPQAPPSLPTQGPSCPAEDGPPALKEKEEPHYIEIWKKHLEAYSGCTLELEESLEASTSQMMNLNL
Gene ID 79048
Swiss prot Q96T21
Synonyms SBP2; THMA1; SECISBP2
Calculated MW 95kDa
Observed MW 110kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, Mouse testis, Mouse thymus, Rat testis
Cellular location Mitochondrion, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

SECISBP2 Rabbit pAb images

ABclonal:Western blot - SECISBP2 Rabbit pAb (A6736)}

Western blot - SECISBP2 Rabbit pAb (A6736)

Western blot analysis of extracts of various cell lines, using SECISBP2 antibody (A6736) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunohistochemistry - SECISBP2 Rabbit pAb (A6736)}

Immunohistochemistry - SECISBP2 Rabbit pAb (A6736)

Immunohistochemistry analysis of paraffin-embedded human liver damage using SECISBP2 antibody (A6736) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - SECISBP2 Rabbit pAb (A6736)}

Immunohistochemistry - SECISBP2 Rabbit pAb (A6736)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using SECISBP2 antibody (A6736) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - SECISBP2 Rabbit pAb (A6736)}

Immunofluorescence - SECISBP2 Rabbit pAb (A6736)

Immunofluorescence analysis of HeLa cells using SECISBP2 Rabbit pAb (A6736) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - SECISBP2 Rabbit pAb (A6736)}

Immunofluorescence - SECISBP2 Rabbit pAb (A6736)

Immunofluorescence analysis of NIH/3T3 cells using SECISBP2 Rabbit pAb (A6736) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - SECISBP2 Rabbit pAb (A6736)}

Immunofluorescence - SECISBP2 Rabbit pAb (A6736)

Immunofluorescence analysis of U2OS cells using SECISBP2 Rabbit pAb (A6736) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A6736 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SECISBP2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SECISBP2. (Distance between topics and target gene indicate popularity.) SECISBP2

* Data provided by citexs.com, for reference only.

Publishing research using A6736? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order