Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Rac1/2/3 Rabbit pAb (A7720)

Review (1) Publications (6) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Rac1/2/3 Rabbit pAb (A7720)

Western blot analysis of extracts of various cell lines, using Rac1/2/3 antibody (A7720) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Western blot - Rac1/2/3 Rabbit pAb (A7720)

Western blot analysis of extracts of A-431 cells, using Rac1/2/3 antibody (A7720) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - Rac1/2/3 Rabbit pAb (A7720)

Immunohistochemistry analysis of paraffin-embedded human gastric using Rac1/2/3 antibody (A7720) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Rac1/2/3 Rabbit pAb (A7720)

Immunofluorescence analysis of C6 cells using Rac1/2/3 Rabbit pAb (A7720) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Rac1/2/3 Rabbit pAb (A7720)

Immunofluorescence analysis of NIH-3T3 cells using Rac1/2/3 Rabbit pAb (A7720) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Review
ABclonal: review for Rac1/2/3 Rabbit pAb(A7720)

You may also interested in:

Overview

Product name Rac1/2/3 Rabbit pAb
Catalog No. A7720
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-192 of human Rac1/2/3 (NP_008839.2).
Sequence MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
Gene ID 5879
Swiss prot P63000
Synonyms MIG5; MRD48; Rac-1; TC-25; p21-Rac1; Rac1/2/3
Calculated MW 21kDa
Observed MW 21kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples A-431, Mouse brain, Rat brain, Rat spleen
Cellular location Cell membrane, Cytoplasm, Cytoplasmic side, Lipid-anchor, Melanosome, Nucleus
Customer validation

WB (Human lung cancer cellRattus norvegicus, Capra hircus, Rattus norvegicus, Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Rac1/2/3 Rabbit pAb images

ABclonal:Western blot - Rac1/2/3 Rabbit pAb (A7720)}

Western blot - Rac1/2/3 Rabbit pAb (A7720)

Western blot analysis of extracts of various cell lines, using Rac1/2/3 antibody (A7720) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Western blot - Rac1/2/3 Rabbit pAb (A7720)}

Western blot - Rac1/2/3 Rabbit pAb (A7720)

Western blot analysis of extracts of A-431 cells, using Rac1/2/3 antibody (A7720) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - Rac1/2/3 Rabbit pAb (A7720)}

Immunohistochemistry - Rac1/2/3 Rabbit pAb (A7720)

Immunohistochemistry analysis of paraffin-embedded human gastric using Rac1/2/3 antibody (A7720) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Rac1/2/3 Rabbit pAb (A7720)}

Immunofluorescence - Rac1/2/3 Rabbit pAb (A7720)

Immunofluorescence analysis of C6 cells using Rac1/2/3 Rabbit pAb (A7720) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Rac1/2/3 Rabbit pAb (A7720)}

Immunofluorescence - Rac1/2/3 Rabbit pAb (A7720)

Immunofluorescence analysis of NIH-3T3 cells using Rac1/2/3 Rabbit pAb (A7720) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Submit an review for A7720

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A7720 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RAC1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RAC1. (Distance between topics and target gene indicate popularity.) RAC1

* Data provided by citexs.com, for reference only.

Publishing research using A7720? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order