Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

RRAGA Rabbit pAb (A15134)

Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - RRAGA Rabbit pAb (A15134)

Western blot analysis of various lysates using RRAGA Rabbit pAb (A15134) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - RRAGA Rabbit pAb (A15134)

Immunohistochemistry analysis of RRAGA in paraffin-embedded human placenta using RRAGA Rabbit pAb (A15134) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name RRAGA Rabbit pAb
Catalog No. A15134
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables several functions, including GTP binding activity; protein dimerization activity; and ubiquitin protein ligase binding activity. Involved in several processes, including cellular response to amino acid starvation; negative regulation of autophagy; and positive regulation of TORC1 signaling. Located in lysosome and nucleus. Colocalizes with GATOR1 complex.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 213-313 of human RRAGA (NP_006561.1).
Sequence VISHYQCKEQRDVHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKHSLLMR
Gene ID 10670
Swiss prot Q7L523
Synonyms FIP1; RAGA; FIP-1; RRAGA
Calculated MW 37kDa
Observed MW 33kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples 293T, Mouse brain, Rat brain, Rat kidney
Cellular location Cytoplasm, Lysosome, Nucleus
Customer validation

WB (Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

RRAGA Rabbit pAb images

ABclonal:Western blot - RRAGA Rabbit pAb (A15134)}

Western blot - RRAGA Rabbit pAb (A15134)

Western blot analysis of various lysates using RRAGA Rabbit pAb (A15134) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - RRAGA Rabbit pAb (A15134)}

Immunohistochemistry - RRAGA Rabbit pAb (A15134)

Immunohistochemistry analysis of RRAGA in paraffin-embedded human placenta using RRAGA Rabbit pAb (A15134) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A15134 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RRAGA. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RRAGA. (Distance between topics and target gene indicate popularity.) RRAGA

* Data provided by citexs.com, for reference only.

Publishing research using A15134? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order