Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

RNF20 Rabbit mAb (A4784)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - RNF20 Rabbit mAb (A4784)

Western blot analysis of extracts of various cell lines, using RNF20 Rabbit mAb (A4784) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Western blot - RNF20 Rabbit mAb (A4784)

Western blot analysis of extracts of various cell lines, using RNF20 Rabbit mAb (A4784) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

You may also interested in:

Overview

Product name RNF20 Rabbit mAb
Catalog No. A4784
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0213

Background

The protein encoded by this gene shares similarity with BRE1 of S. cerevisiae. The protein encoded by this human gene is an E3 ubiquitin ligase that regulates chromosome structure by monoubiquitinating histone H2B. This protein acts as a putative tumor suppressor and positively regulates the p53 tumor suppressor as well as numerous histone H2A and H2B genes. In contrast, this protein also suppresses the expression of several protooncogenes and growth-related genes, including many genes that are induced by epidermal growth factor. This gene selectively suppresses the expression of some genes by interfering with chromatin recruitment of transcription elongation factor SII (TFIIS).

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RNF20 (Q5VTR2).
Sequence MSGIGNKRAAGEPGTSMPPEKKAAVEDSGTTVETIKLGGVSSTEELDIRTLQTKNRKLAEMLDQRQAIEDELREHIEKLERRQATDDASLLIVNRYWSQF
Gene ID 56254
Swiss prot Q5VTR2
Synonyms BRE1; BRE1A; hBRE1; RNF20
Calculated MW 114kDa
Observed MW 80kDa/120kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa, 293T, C2C12, Mouse testis
Cellular location Nucleus

Research Area

RNF20 Rabbit mAb images

ABclonal:Western blot - RNF20 Rabbit mAb (A4784)}

Western blot - RNF20 Rabbit mAb (A4784)

Western blot analysis of extracts of various cell lines, using RNF20 Rabbit mAb (A4784) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Western blot - RNF20 Rabbit mAb (A4784)}

Western blot - RNF20 Rabbit mAb (A4784)

Western blot analysis of extracts of various cell lines, using RNF20 Rabbit mAb (A4784) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

Inquire About This Product

Submit your question about A4784 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RNF20. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RNF20. (Distance between topics and target gene indicate popularity.) RNF20

* Data provided by citexs.com, for reference only.

Publishing research using A4784? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order