Products > Catalog Antibodies > Polyclonal Antibodies

RNASEL Rabbit pAb (A9840)

Tested applications:WB IHC ICC IF IP ChIP ChIP-seq RIP FC ELISA MeDIP Nucleotide Array DB FACS CoIPReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using RNASEL antibody (A9840) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	RNASEL Rabbit pAb
Catalog No.	A9840
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a component of the interferon-regulated 2-5A system that functions in the antiviral and antiproliferative roles of interferons. Mutations in this gene have been associated with predisposition to prostate cancer and this gene is a candidate for the hereditary prostate cancer 1 (HPC1) allele.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 472-741 of human RNASEL (NP_066956.1).
Sequence	VQELHLSCGYTHQDLQPQNILIDSKKAAHLADFDKSIKWAGDPQEVKRDLEDLGRLVLYVVKKGSISFEDLKAQSNEEVVQLSPDEETKDLIHRLFHPGEHVRDCLSDLLGHPFFWTWESRYRTLRNVGNESDIKTRKSESEILRLLQPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGAGGASGLASPGC
Gene ID	6041
Swiss prot	Q05823
Synonyms	RNASEL; PRCA1; RNS4
Calculated MW	73kDa/83kDa
Observed MW	84kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC ICC IF IP ChIP ChIP-seq RIP FC ELISA MeDIP Nucleotide Array DB FACS CoIP
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key	Western blotting
Positive samples	293T, HT-29, Jurkat
Cellular location	Cytoplasm, Mitochondrion
Customer validation	WB(Homo sapiens)