Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

RNASEL Rabbit pAb (A9840)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using RNASEL antibody (A9840) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Western blot analysis of Mouse spleen, using RNASEL antibody (A9840) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

You may also interested in:

Overview

Product name	RNASEL Rabbit pAb
Catalog No.	A9840
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a component of the interferon-regulated 2-5A system that functions in the antiviral and antiproliferative roles of interferons. The protein is involved in innate immunity and is active against multiple RNA viruses, including the influenza and SARS-CoV-2 viruses. Mutations in this gene have been associated with predisposition to prostate cancer and this gene is a candidate for the hereditary prostate cancer 1 (HPC1) allele.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 472-741 of human RNASEL (NP_066956.1).
Sequence	VQELHLSCGYTHQDLQPQNILIDSKKAAHLADFDKSIKWAGDPQEVKRDLEDLGRLVLYVVKKGSISFEDLKAQSNEEVVQLSPDEETKDLIHRLFHPGEHVRDCLSDLLGHPFFWTWESRYRTLRNVGNESDIKTRKSESEILRLLQPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGAGGASGLASPGC
Gene ID	6041
Swiss prot	Q05823
Synonyms	RNS4; PRCA1
Calculated MW	84kDa
Observed MW	80KDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. May contain BSA. If BSA-free batch required, please contact us.
Application key	Western blotting
Positive samples	THP-1, Mouse spleen, Rat spleen
Cellular location	Cytoplasm, Mitochondrion
Customer validation	WB(Homo sapiens)

Research Area

Research Area & PathwaysImmunology & InflammationCytokinesInterferons

RNASEL Rabbit pAb images

Western blot - RNASEL Rabbit pAb (A9840)

Product Protocols

Inquire About This Product

Submit your question about A9840 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RNASEL. (Numbers indicate number of published articles where both targets appear.)

◀1/▶

Related Research Area

Based on existing publications, the following research topics are related to RNASEL. (Distance between topics and target gene indicate popularity.) RNASEL

* Data provided by citexs.com, for reference only.