Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

RIPK1/RIP Rabbit pAb (A7414)

Review (1) Publications (35) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - RIPK1/RIP Rabbit pAb (A7414)

Western blot analysis of lysates from C6 cells, using RIPK1/RIP Rabbit pAb (A7414) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Western blot - RIPK1/RIP Rabbit pAb (A7414)

Western blot analysis of various lysates using RIPK1/RIP Rabbit pAb (A7414) at 1:1000 dilution.Jurkat cells were treated by Etoposide (25 uM) at 37℃ for 5 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - RIPK1/RIP Rabbit pAb (A7414)

Immunohistochemistry analysis of RIPK1/RIP in paraffin-embedded mouse colon using RIPK1/RIP Rabbit pAb (A7414) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - RIPK1/RIP Rabbit pAb (A7414)

Immunofluorescence analysis of NIH/3T3 cells using RIPK1/RIP Rabbit pAb (A7414) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for RIPK1/RIP Rabbit pAb(A7414)

You may also interested in:

Overview

Product name RIPK1/RIP Rabbit pAb
Catalog No. A7414
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein plays a role in inflammation and cell death in response to tissue damage, pathogen recognition, and as part of developmental regulation. RIPK1/RIPK3 kinase-mediated necrosis is referred to as necroptosis. Genetic disruption of this gene in mice results in death shortly after birth.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RIPK1/RIP (NP_003795.2).
Sequence LMHVLKAEMSTPLSVKGRIILEIIEGMCYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVDGTAKKNGGTLYYMAPEHLND
Gene ID 8737
Swiss prot Q13546
Synonyms RIP; RIP1; AIEFL; IMD57; RIP-1; RIPK1/RIP
Calculated MW 76kDa
Observed MW 75kDa/38kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples Raji, Jurkat, Mouse liver, C6
Cellular location Cell membrane, Cytoplasm
Customer validation

WB (human kidney cancer cellsGallus gallus, Gallus gallus, Homo sapiens, Ctenopharyngodon idellus, Marine Streptomyces sp, Mus musculus, Sus scrofa, Gallus gallus domesticus, Rattus norvegicus)

IHC (Gallus gallus, Rattus norvegicus, Homo sapiens, homo sapiens)

IP (Mus musculus)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

RIPK1/RIP Rabbit pAb images

ABclonal:Western blot - RIPK1/RIP Rabbit pAb (A7414)}

Western blot - RIPK1/RIP Rabbit pAb (A7414)

Western blot analysis of lysates from C6 cells, using RIPK1/RIP Rabbit pAb (A7414) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
ABclonal:Western blot - RIPK1/RIP Rabbit pAb (A7414)}

Western blot - RIPK1/RIP Rabbit pAb (A7414)

Western blot analysis of various lysates using RIPK1/RIP Rabbit pAb (A7414) at 1:1000 dilution.Jurkat cells were treated by Etoposide (25 uM) at 37℃ for 5 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - RIPK1/RIP Rabbit pAb (A7414)}

Immunohistochemistry - RIPK1/RIP Rabbit pAb (A7414)

Immunohistochemistry analysis of RIPK1/RIP in paraffin-embedded mouse colon using RIPK1/RIP Rabbit pAb (A7414) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - RIPK1/RIP Rabbit pAb (A7414)}

Immunofluorescence - RIPK1/RIP Rabbit pAb (A7414)

Immunofluorescence analysis of NIH/3T3 cells using RIPK1/RIP Rabbit pAb (A7414) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A7414

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A7414 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RIPK1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RIPK1. (Distance between topics and target gene indicate popularity.) RIPK1

* Data provided by citexs.com, for reference only.

Publishing research using A7414? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order