Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

RING1B/RNF2 Rabbit mAb (A3564)

Review (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - RING1B/RNF2 Rabbit mAb (A3564)

Western blot analysis of various lysates using RING1B/RNF2 Rabbit mAb (A3564) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunoprecipitation - RING1B/RNF2 Rabbit mAb (A3564)

Immunoprecipitation analysis of 300 μg extracts of U-937 cells using 3 μg RING1B/RNF2 antibody (A3564). Western blot was performed from the immunoprecipitate using RING1B/RNF2 antibody (A3564) at a dilution of 1:500.

Review
ABclonal: review for RING1B/RNF2 Rabbit mAb(A3564)

You may also interested in:

Overview

Product name RING1B/RNF2 Rabbit mAb
Catalog No. A3564
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0802

Background

Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RING1B/RNF2 (Q99496).
Sequence LRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTS
Gene ID 6045
Swiss prot Q99496
Synonyms BAP1; DING; BAP-1; HIPI3; RING2; LUSYAM; RING1B; RING1B/RNF2
Calculated MW 38kDa
Observed MW 38kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:2000
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunoprecipitation    
Positive samples THP-1, U-937, Mouse testis, Mouse spleen, Rat testis
Cellular location Chromosome, Nucleus
Customer validation

(E14)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

RING1B/RNF2 Rabbit mAb images

ABclonal:Western blot - RING1B/RNF2 Rabbit mAb (A3564)}

Western blot - RING1B/RNF2 Rabbit mAb (A3564)

Western blot analysis of various lysates using RING1B/RNF2 Rabbit mAb (A3564) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
ABclonal:Immunoprecipitation - RING1B/RNF2 Rabbit mAb (A3564)}

Immunoprecipitation - RING1B/RNF2 Rabbit mAb (A3564)

Immunoprecipitation analysis of 300 μg extracts of U-937 cells using 3 μg RING1B/RNF2 antibody (A3564). Western blot was performed from the immunoprecipitate using RING1B/RNF2 antibody (A3564) at a dilution of 1:500.

Submit an review for A3564

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A3564 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RNF2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RNF2. (Distance between topics and target gene indicate popularity.) RNF2

* Data provided by citexs.com, for reference only.

Publishing research using A3564? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order