Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

RING1A Rabbit mAb (A19750)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - RING1A Rabbit mAb (A19750)

Western blot analysis of various lysates using RING1A Rabbit mAb (A19750) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - RING1A Rabbit mAb (A19750)

Immunohistochemistry analysis of RING1A in paraffin-embedded human thyroid cancer using RING1A Rabbit mAb (A19750) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunoprecipitation - RING1A Rabbit mAb (A19750)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg RING1A antibody (A19750). Western blot was performed from the immunoprecipitate using RING1A antibody (A19750) at a dilution of 1:1000.

You may also interested in:

Overview

Product name RING1A Rabbit mAb
Catalog No. A19750
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC2278

Background

This gene belongs to the RING finger family, members of which encode proteins characterized by a RING domain, a zinc-binding motif related to the zinc finger domain. The gene product can bind DNA and can act as a transcriptional repressor. It is associated with the multimeric polycomb group protein complex. The gene product interacts with the polycomb group proteins BMI1, EDR1, and CBX4, and colocalizes with these proteins in large nuclear domains. It interacts with the CBX4 protein via its glycine-rich C-terminal domain. The gene maps to the HLA class II region, where it is contiguous with the RING finger genes FABGL and HKE4.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RING1A A (Q06587).
Sequence DPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMSGGEGEPGEGEGDGEDVSSDSAPDSAPGPAP
Gene ID 6015
Swiss prot Q06587
Synonyms RNF1; RING1A
Calculated MW 42kDa
Observed MW 54kDa

Applications

Reactivity Human
Tested applications Testing results
IHC-P Human
WB Human
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunoprecipitation    
Positive samples HeLa, HCT116
Cellular location Cytosol, Nuclear speck, Nucleoplasm, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

RING1A Rabbit mAb images

ABclonal:Western blot - RING1A Rabbit mAb (A19750)}

Western blot - RING1A Rabbit mAb (A19750)

Western blot analysis of various lysates using RING1A Rabbit mAb (A19750) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - RING1A Rabbit mAb (A19750)}

Immunohistochemistry - RING1A Rabbit mAb (A19750)

Immunohistochemistry analysis of RING1A in paraffin-embedded human thyroid cancer using RING1A Rabbit mAb (A19750) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
ABclonal:Immunoprecipitation - RING1A Rabbit mAb (A19750)}

Immunoprecipitation - RING1A Rabbit mAb (A19750)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg RING1A antibody (A19750). Western blot was performed from the immunoprecipitate using RING1A antibody (A19750) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A19750 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RING1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RING1. (Distance between topics and target gene indicate popularity.) RING1

* Data provided by citexs.com, for reference only.

Publishing research using A19750? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order