Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

RBP4 Rabbit mAb (A8807)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - RBP4 Rabbit mAb (A8807)

Western blot analysis of extracts of HepG2 cells, using RBP4 antibody (A8807) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunofluorescence - RBP4 Rabbit mAb (A8807)

Immunofluorescence analysis of rat liver using RBP4 Rabbit mAb (A8807) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - RBP4 Rabbit mAb (A8807)

Immunofluorescence analysis of human liver using RBP4 Rabbit mAb (A8807) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - RBP4 Rabbit mAb (A8807)

Immunofluorescence analysis of mouse liver using RBP4 Rabbit mAb (A8807) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name RBP4 Rabbit mAb
Catalog No. A8807
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC1311

Background

This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 102-201 of human RBP4 (P02753).
Sequence AKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Gene ID 5950
Swiss prot P02753
Synonyms RDCCAS; MCOPCB10; RBP4
Calculated MW 21kDa
Observed MW 22kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IF/ICC HumanMouseRat
WB Human
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Hep G2
Cellular location Extracellular exosome, Extracellular region, Extracellular space

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

RBP4 Rabbit mAb images

ABclonal:Western blot - RBP4 Rabbit mAb (A8807)}

Western blot - RBP4 Rabbit mAb (A8807)

Western blot analysis of extracts of HepG2 cells, using RBP4 antibody (A8807) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
ABclonal:Immunofluorescence - RBP4 Rabbit mAb (A8807)}

Immunofluorescence - RBP4 Rabbit mAb (A8807)

Immunofluorescence analysis of rat liver using RBP4 Rabbit mAb (A8807) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - RBP4 Rabbit mAb (A8807)}

Immunofluorescence - RBP4 Rabbit mAb (A8807)

Immunofluorescence analysis of human liver using RBP4 Rabbit mAb (A8807) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - RBP4 Rabbit mAb (A8807)}

Immunofluorescence - RBP4 Rabbit mAb (A8807)

Immunofluorescence analysis of mouse liver using RBP4 Rabbit mAb (A8807) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A8807 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RBP4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RBP4. (Distance between topics and target gene indicate popularity.) RBP4

* Data provided by citexs.com, for reference only.

Publishing research using A8807? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Proteins (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order