Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

RAD17 Rabbit pAb (A5359)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - RAD17 Rabbit pAb (A5359)

Western blot analysis of various lysates using RAD17 Rabbit pAb (A5359) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunoprecipitation - RAD17 Rabbit pAb (A5359)

Immunoprecipitation analysis of 200 μg extracts of K562 cells using 1 μg RAD17 antibody (A5359). Western blot was performed from the immunoprecipitate using RAD17 antibody (A5359) at a dilution of 1:1000.

You may also interested in:

Overview

Product name RAD17 Rabbit pAb
Catalog No. A5359
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs. This protein binds to chromatin prior to DNA damage and is phosphorylated by the checkpoint kinase ATR following damage. This protein recruits the RAD1-RAD9-HUS1 checkpoint protein complex onto chromatin after DNA damage, which may be required for its phosphorylation. The phosphorylation of this protein is required for the DNA-damage-induced cell cycle G2 arrest, and is thought to be a critical early event during checkpoint signaling in DNA-damaged cells. Multiple alternatively spliced transcript variants of this gene, which encode four distinct protein isoforms, have been reported. Two pseudogenes, located on chromosomes 7 and 13, have been identified.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 391-670 of human RAD17 (NP_002864.1).
Sequence KILYCKRASLTELDSPRLPSHLSEYERDTLLVEPEEVVEMSHMPGDLFNLYLHQNYIDFFMEIDDIVRASEFLSFADILSGDWNTRSLLREYSTSIATRGVMHSNKARGYAHCQGGGSSFRPLHKPQWFLINKKYRENCLAAKALFPDFCLPALCLQTQLLPYLALLTIPMRNQAQISFIQDIGRLPLKRHFGRLKMEALTDREHGMIDPDSGDEAQLNGGHSAEESLGEPTQATVPETWSLPLSQNSASELPASQPQPFSAQGDMEENIIIEDYESDGT
Gene ID 5884
Swiss prot O75943
Synonyms CCYC; R24L; RAD24; HRAD17; RAD17SP; RAD17
Calculated MW 77kDa
Observed MW 77kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunoprecipitation    
Positive samples SW480, BT-474, K-562, 22Rv1, Raji
Cellular location Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

RAD17 Rabbit pAb images

ABclonal:Western blot - RAD17 Rabbit pAb (A5359)}

Western blot - RAD17 Rabbit pAb (A5359)

Western blot analysis of various lysates using RAD17 Rabbit pAb (A5359) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
ABclonal:Immunoprecipitation - RAD17 Rabbit pAb (A5359)}

Immunoprecipitation - RAD17 Rabbit pAb (A5359)

Immunoprecipitation analysis of 200 μg extracts of K562 cells using 1 μg RAD17 antibody (A5359). Western blot was performed from the immunoprecipitate using RAD17 antibody (A5359) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A5359 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RAD17. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RAD17. (Distance between topics and target gene indicate popularity.) RAD17

* Data provided by citexs.com, for reference only.

Publishing research using A5359? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order