Publications (4) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | RAB11A Rabbit mAb |
---|---|
Catalog No. | A3251 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0767 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RAB11A (P62491). |
---|---|
Sequence | ENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHV |
Gene ID | 8766 |
Swiss prot | P62491 |
Synonyms | YL8; RAB11A |
Calculated MW | 24kDa |
Observed MW | 24kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | Testing results |
IF/ICC | |
WB | |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting Immunofluorescence |
Positive samples | HeLa, A549, SH-SY5Y, Mouse testis, Mouse brain, Rat testis, Rat brain, Rat spleen |
Cellular location | Cell membrane, Cleavage furrow, Cytoplasmic side, Cytoplasmic vesicle, Lipid-anchor, Peripheral membrane protein, Recycling endosome membrane, phagosome, phagosome membrane |
Customer validation | WB (Mus musculus, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A3251 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on RAB11A. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to RAB11A. (Distance between topics and target gene indicate popularity.) RAB11A
* Data provided by citexs.com, for reference only.
Publishing research using A3251? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.