Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

RAB11A Rabbit mAb (A3251)

Publications (4) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - RAB11A Rabbit mAb (A3251)

Western blot analysis of extracts of various cell lines, using RAB11A Rabbit mAb (A3251) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunofluorescence - RAB11A Rabbit mAb (A3251)

Confocal imaging of HeLa cells using RAB11A Rabbit mAb (A3251, dilution 1:100) (Red).The cells were counterstained with α-Tubulin Rabbit mAb (AC049, dilution 1:100) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

You may also interested in:

Overview

Product name RAB11A Rabbit mAb
Catalog No. A3251
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0767

Background

The protein encoded by this gene belongs to the Rab family of the small GTPase superfamily. It is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RAB11A (P62491).
Sequence ENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHV
Gene ID 8766
Swiss prot P62491
Synonyms YL8; RAB11A
Calculated MW 24kDa
Observed MW 24kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IF/ICC Human
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HeLa, A549, SH-SY5Y, Mouse testis, Mouse brain, Rat testis, Rat brain, Rat spleen
Cellular location Cell membrane, Cleavage furrow, Cytoplasmic side, Cytoplasmic vesicle, Lipid-anchor, Peripheral membrane protein, Recycling endosome membrane, phagosome, phagosome membrane
Customer validation

WB (Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

RAB11A Rabbit mAb images

ABclonal:Western blot - RAB11A Rabbit mAb (A3251)}

Western blot - RAB11A Rabbit mAb (A3251)

Western blot analysis of extracts of various cell lines, using RAB11A Rabbit mAb (A3251) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
ABclonal:Immunofluorescence - RAB11A Rabbit mAb (A3251)}

Immunofluorescence - RAB11A Rabbit mAb (A3251)

Confocal imaging of HeLa cells using RAB11A Rabbit mAb (A3251, dilution 1:100) (Red).The cells were counterstained with α-Tubulin Rabbit mAb (AC049, dilution 1:100) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

Inquire About This Product

Submit your question about A3251 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RAB11A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RAB11A. (Distance between topics and target gene indicate popularity.) RAB11A

* Data provided by citexs.com, for reference only.

Publishing research using A3251? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order