Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Pumilio 1 Rabbit pAb (A6108)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Pumilio 1 Rabbit pAb (A6108)

Western blot analysis of extracts of various cell lines, using Pumilio 1 antibody (A6108) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 15s.

ABclonal:Immunofluorescence - Pumilio 1 Rabbit pAb (A6108)

Immunofluorescence analysis of U2OS cells using Pumilio 1 antibody (A6108) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Pumilio 1 Rabbit pAb
Catalog No. A6108
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the PUF family, evolutionarily conserved RNA-binding proteins related to the Pumilio proteins of Drosophila and the fem-3 mRNA binding factor proteins of C. elegans. The encoded protein contains a sequence-specific RNA binding domain comprised of eight repeats and N- and C-terminal flanking regions, and serves as a translational regulator of specific mRNAs by binding to their 3' untranslated regions. The evolutionarily conserved function of the encoded protein in invertebrates and lower vertebrates suggests that the human protein may be involved in translational regulation of embryogenesis, and cell development and differentiation. Alternatively spliced transcript variants encoding different isoforms have been described.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human Pumilio 1 (NP_055491.1).
Sequence MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIGVAGRSQDDAMVDYFFQRQHGEQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGRAMGEQLLPGKKFWETDESSKDGPKGIFLGDQWRDSAWGTSDHSVSQPIMVQRRPGQSFHVNSEVNSVLSPRSESGGLGVSMVEYVLSSSPGDSCLRKGGFGPRDADSDENDKGEKKNKGTFDGDKLGDLKEEGDVMDKTN
Gene ID 9698
Swiss prot Q14671
Synonyms PUMH; HSPUM; PUMH1; PUML1; SCA47; Pumilio 1
Calculated MW 126kDa
Observed MW 135kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Mouse brain, Rat brain
Cellular location Cytoplasm, Cytoplasmic granule, P-body
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Pumilio 1 Rabbit pAb images

ABclonal:Western blot - Pumilio 1 Rabbit pAb (A6108)}

Western blot - Pumilio 1 Rabbit pAb (A6108)

Western blot analysis of extracts of various cell lines, using Pumilio 1 antibody (A6108) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 15s.
ABclonal:Immunofluorescence - Pumilio 1 Rabbit pAb (A6108)}

Immunofluorescence - Pumilio 1 Rabbit pAb (A6108)

Immunofluorescence analysis of U2OS cells using Pumilio 1 antibody (A6108) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A6108 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PUM1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PUM1. (Distance between topics and target gene indicate popularity.) PUM1

* Data provided by citexs.com, for reference only.

Publishing research using A6108? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order