Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Progesterone Receptor Rabbit pAb (A0321)

Review (1) Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Progesterone Receptor Rabbit pAb (A0321)

Western blot analysis of various lysates using Progesterone Receptor Rabbit pAb (A0321) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - Progesterone Receptor Rabbit pAb (A0321)

Immunohistochemistry analysis of Progesterone Receptor in paraffin-embedded rat fallopian tube using Progesterone Receptor Rabbit pAb (A0321) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Progesterone Receptor Rabbit pAb (A0321)

Immunohistochemistry analysis of Progesterone Receptor in paraffin-embedded human breast cancer using Progesterone Receptor Rabbit pAb (A0321) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Progesterone Receptor Rabbit pAb (A0321)

Immunohistochemistry analysis of Progesterone Receptor in paraffin-embedded mouse uterus using Progesterone Receptor Rabbit pAb (A0321) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Review
ABclonal: review for Progesterone Receptor Rabbit pAb(A0321)

You may also interested in:

Overview

Product name Progesterone Receptor Rabbit pAb
Catalog No. A0321
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the steroid receptor superfamily. The encoded protein mediates the physiological effects of progesterone, which plays a central role in reproductive events associated with the establishment and maintenance of pregnancy. This gene uses two distinct promotors and translation start sites in the first exon to produce several transcript variants, both protein coding and non-protein coding. Two of the isoforms (A and B) are identical except for an additional 165 amino acids found in the N-terminus of isoform B and mediate their own response genes and physiologic effects with little overlap.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human Progesterone Receptor (NP_000917.3).
Sequence MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLAPSGPGQSQPSPPACEVTSSWCLFGPELPEDPPAAPATQRVLSPLMSRSGCKVGDSSGTAAAHKVLPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAGPLLKGKPRALGGAAAG
Gene ID 5241
Swiss prot P06401
Synonyms PR; NR3C3; Progesterone Receptor
Calculated MW 99kDa
Observed MW 118kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples BT-474, Mouse brain, Rat brain
Cellular location Cytoplasm, Cytoplasm, Mitochondrion outer membrane, Nucleus
Customer validation

WB (IshikawaHomo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Progesterone Receptor Rabbit pAb images

ABclonal:Western blot - Progesterone Receptor Rabbit pAb (A0321)}

Western blot - Progesterone Receptor Rabbit pAb (A0321)

Western blot analysis of various lysates using Progesterone Receptor Rabbit pAb (A0321) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunohistochemistry - Progesterone Receptor Rabbit pAb (A0321)}

Immunohistochemistry - Progesterone Receptor Rabbit pAb (A0321)

Immunohistochemistry analysis of Progesterone Receptor in paraffin-embedded rat fallopian tube using Progesterone Receptor Rabbit pAb (A0321) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Progesterone Receptor Rabbit pAb (A0321)}

Immunohistochemistry - Progesterone Receptor Rabbit pAb (A0321)

Immunohistochemistry analysis of Progesterone Receptor in paraffin-embedded human breast cancer using Progesterone Receptor Rabbit pAb (A0321) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Progesterone Receptor Rabbit pAb (A0321)}

Immunohistochemistry - Progesterone Receptor Rabbit pAb (A0321)

Immunohistochemistry analysis of Progesterone Receptor in paraffin-embedded mouse uterus using Progesterone Receptor Rabbit pAb (A0321) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Submit an review for A0321

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A0321 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PGR. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PGR. (Distance between topics and target gene indicate popularity.) PGR

* Data provided by citexs.com, for reference only.

Publishing research using A0321? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order