Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPFCMCUT&TagmeRIPInhibition
Reactivity:Human
Product name | Pituitary homeobox 2 (PITX2) Rabbit mAb |
---|---|
Catalog No. | A22173 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC56103 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pituitary homeobox 2 (PITX2) (NP_700475.1). |
---|---|
Sequence | METNCRKLVSACVQLGVQPAAVECLFSKDSEIKKVEFTDSPESRKEAASSKFFPRQHPGANEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQEL |
Gene ID | 5308 |
Swiss prot | Q99697 |
Synonyms | RS; RGS; ARP1; Brx1; IDG2; IGDS; IHG2; PTX2; RIEG; ASGD4; IGDS2; IRID2; Otlx2; RIEG1 |
Calculated MW | 35kDa |
Observed MW | 37kDa |
Reactivity | Human |
---|---|
Tested applications | Testing results |
WB | |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | HeLa |
Cellular location | Nucleus |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A22173 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on PITX2. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to PITX2. (Distance between topics and target gene indicate popularity.) PITX2
* Data provided by citexs.com, for reference only.
Publishing research using A22173? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.