Product Type > Antibodies > Antibody Duos > Phosphorylated Antibody Duos

Phospho-PPP1CA-T320 Antibody kit (RK04085)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Phospho-PPP1CA-T320 Rabbit pAb (AP0786)
ABclonal:Western blot - Phospho-PPP1CA-T320 Rabbit pAb (AP0786)
ABclonal:Western blot - Phospho-PPP1CA-T320 Rabbit pAb (AP0786)
ABclonal:Immunohistochemistry - Phospho-PPP1CA-T320 Rabbit pAb (AP0786)
ABclonal:Immunohistochemistry - Phospho-PPP1CA-T320 Rabbit pAb (AP0786)
ABclonal:Western blot - PPP1CA Rabbit pAb (A12468)
ABclonal:Immunofluorescence - PPP1CA Rabbit pAb (A12468)

Overview

Product name Phospho-PPP1CA-T320 Antibody kit
Catalog No. RK04085

Product Component

Product name Catalog No. Positive Applications Species Reactivity
Phospho-PPP1CA-T320 Rabbit pAb AP0786 WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition Human, Mouse, Rat
PPP1CA Rabbit pAb A12468 WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition Human, Mouse, Rat
The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). This broadly expressed gene encodes the alpha subunit of the PP1 complex that associates with over 200 regulatory proteins to form holoenzymes which dephosphorylate their biological targets with high specificity. PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Increased PP1 activity has been observed in the end stage of heart failure. Studies suggest that PP1 is an important regulator of cardiac function and that PP1 deregulation is implicated in diabetes and multiple types of cancer. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 230-330 of human PPP1CA (NP_002699.1).
A synthetic phosphorylated peptide around T320 of human PPP1CA (NP_002699.1).
Sequence EVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK
PITPP
Gene ID 5499
Swiss prot P62136
Synonyms PP1A; PP-1A; PPP1A; PP1alpha; Phospho-PPP1CA-T320
Calculated MW 38kDa
Observed MW 38kDa
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal,50% glycerol,pH7.3.
Cellular location Cytoplasm,Nucleus,nucleolus,nucleoplasm
Phospho-PPP1CA-T320 Rabbit pAb (AP0786)
ABclonal:Western blot - Phospho-PPP1CA-T320 Rabbit pAb (AP0786)}
Western blot - Phospho-PPP1CA-T320 Rabbit pAb (AP0786)

Western blot analysis of lysates from NIH/3T3 cells using Phospho-PPP1CA-T320 Rabbit pAb (AP0786) at 1:500 dilution. NIH/3T3 cells were treated by Calyculin A (100 nM) at 37℃ for 30 minutes after serum-starvation overnight.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 60s.

ABclonal:Western blot - Phospho-PPP1CA-T320 Rabbit pAb (AP0786)}
Western blot - Phospho-PPP1CA-T320 Rabbit pAb (AP0786)

Western blot analysis of lysates from HeLa cells using Phospho-PPP1CA-T320 Rabbit pAb (AP0786) at 1:500 dilution. HeLa cells were treated by 10% FBS at 37℃ for 30 minutes after serum-starvation overnight.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Enhanced Kit (RM00021).
Exposuretime: 30s.

ABclonal:Western blot - Phospho-PPP1CA-T320 Rabbit pAb (AP0786)}
Western blot - Phospho-PPP1CA-T320 Rabbit pAb (AP0786)

Western blot analysis of lysates from C6 cells using Phospho-PPP1CA-T320 Rabbit pAb (AP0786) at 1:500 dilution. C6 cells were treated by tunicamycin (2 μg/ml) for 8 hours.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 60s.

ABclonal:Immunohistochemistry - Phospho-PPP1CA-T320 Rabbit pAb (AP0786)}
Immunohistochemistry - Phospho-PPP1CA-T320 Rabbit pAb (AP0786)

Immunohistochemistry analysis of Phospho-PPP1CA-T320 in paraffin-embedded rat lung using Phospho-PPP1CA-T320 Rabbit pAb (AP0786) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Phospho-PPP1CA-T320 Rabbit pAb (AP0786)}
Immunohistochemistry - Phospho-PPP1CA-T320 Rabbit pAb (AP0786)

Immunohistochemistry analysis of Phospho-PPP1CA-T320 in paraffin-embedded human gastric cancer using Phospho-PPP1CA-T320 Rabbit pAb (AP0786) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.


PPP1CA Rabbit pAb (A12468)
ABclonal:Western blot - PPP1CA Rabbit pAb (A12468)}
Western blot - PPP1CA Rabbit pAb (A12468)

Western blot analysis of various lysates, using PPP1CA antibody (A12468) at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.5s.

ABclonal:Immunofluorescence - PPP1CA Rabbit pAb (A12468)}
Immunofluorescence - PPP1CA Rabbit pAb (A12468)

Immunofluorescence analysis of PC-12 cells using PPP1CA Rabbit pAb (A12468) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about RK04085 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PPP1CA. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PPP1CA. (Distance between topics and target gene indicate popularity.) PPP1CA

* Data provided by citexs.com, for reference only.

Publishing research using RK04085? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Discontinued

Contact us to order