Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | Phospho-PPP1CA-T320 Antibody kit |
---|---|
Catalog No. | RK04085 |
Product name | Catalog No. | Positive Applications | Species Reactivity |
---|---|---|---|
Phospho-PPP1CA-T320 Rabbit pAb | AP0786 | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition | Human, Mouse, Rat |
PPP1CA Rabbit pAb | A12468 | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition | Human, Mouse, Rat |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 230-330 of human PPP1CA (NP_002699.1). A synthetic phosphorylated peptide around T320 of human PPP1CA (NP_002699.1). |
---|---|
Sequence | EVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK PITPP |
Gene ID | 5499 |
Swiss prot | P62136 |
Synonyms | PP1A; PP-1A; PPP1A; PP1alpha; Phospho-PPP1CA-T320 |
Calculated MW | 38kDa |
---|---|
Observed MW | 38kDa |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal,50% glycerol,pH7.3. |
Cellular location | Cytoplasm,Nucleus,nucleolus,nucleoplasm |
Western blot analysis of lysates from NIH/3T3 cells using Phospho-PPP1CA-T320 Rabbit pAb (AP0786) at 1:500 dilution. NIH/3T3 cells were treated by Calyculin A (100 nM) at 37℃ for 30 minutes after serum-starvation overnight.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 60s.
Western blot analysis of lysates from HeLa cells using Phospho-PPP1CA-T320 Rabbit pAb (AP0786) at 1:500 dilution. HeLa cells were treated by 10% FBS at 37℃ for 30 minutes after serum-starvation overnight.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Enhanced Kit (RM00021).
Exposuretime: 30s.
Western blot analysis of lysates from C6 cells using Phospho-PPP1CA-T320 Rabbit pAb (AP0786) at 1:500 dilution. C6 cells were treated by tunicamycin (2 μg/ml) for 8 hours.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 60s.
Immunohistochemistry analysis of Phospho-PPP1CA-T320 in paraffin-embedded rat lung using Phospho-PPP1CA-T320 Rabbit pAb (AP0786) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of Phospho-PPP1CA-T320 in paraffin-embedded human gastric cancer using Phospho-PPP1CA-T320 Rabbit pAb (AP0786) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Western blot analysis of various lysates, using PPP1CA antibody (A12468) at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.5s.
Submit your question about RK04085 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on PPP1CA. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to PPP1CA. (Distance between topics and target gene indicate popularity.) PPP1CA
* Data provided by citexs.com, for reference only.
Publishing research using RK04085? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.
Discontinued