Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Parkin Rabbit pAb (A11172)

Publications (7) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Parkin Rabbit pAb (A11172)

Western blot analysis of various lysates using Parkin Rabbit pAb (A11172) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - Parkin Rabbit pAb (A11172)

Immunohistochemistry analysis of Parkin in paraffin-embedded Rat kidney tissue using Parkin Rabbit pAb (A11172) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - Parkin Rabbit pAb (A11172)

Immunohistochemistry analysis of Parkin in paraffin-embedded Mouse kidney tissue using Parkin Rabbit pAb (A11172) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - Parkin Rabbit pAb (A11172)

Immunofluorescence analysis of C6 cells using Parkin Rabbit pAb (A11172) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Parkin Rabbit pAb (A11172)

Immunofluorescence analysis of NIH/3T3 cells using Parkin Rabbit pAb (A11172) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Parkin Rabbit pAb
Catalog No. A11172
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The precise function of this gene is unknown; however, the encoded protein is a component of a multiprotein E3 ubiquitin ligase complex that mediates the targeting of substrate proteins for proteasomal degradation. Mutations in this gene are known to cause Parkinson disease and autosomal recessive juvenile Parkinson disease. Alternative splicing of this gene produces multiple transcript variants encoding distinct isoforms. Additional splice variants of this gene have been described but currently lack transcript support.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-387 of human Parkin (NP_004553.2).
Sequence MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTT
Gene ID 5071
Swiss prot O60260
Synonyms PDJ; AR-JP; LPRS2; PARK2; Parkin
Calculated MW 52kDa
Observed MW 52kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples C6, 293T
Cellular location Cytoplasm, Endoplasmic reticulum, Mitochondrion, Nucleus, cytosol
Customer validation

WB (Mus musculus, Megalobrama amblycephala, Homo sapiens, Gallus gallus)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Parkin Rabbit pAb images

ABclonal:Western blot - Parkin Rabbit pAb (A11172)}

Western blot - Parkin Rabbit pAb (A11172)

Western blot analysis of various lysates using Parkin Rabbit pAb (A11172) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
ABclonal:Immunohistochemistry - Parkin Rabbit pAb (A11172)}

Immunohistochemistry - Parkin Rabbit pAb (A11172)

Immunohistochemistry analysis of Parkin in paraffin-embedded Rat kidney tissue using Parkin Rabbit pAb (A11172) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - Parkin Rabbit pAb (A11172)}

Immunohistochemistry - Parkin Rabbit pAb (A11172)

Immunohistochemistry analysis of Parkin in paraffin-embedded Mouse kidney tissue using Parkin Rabbit pAb (A11172) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
ABclonal:Immunofluorescence - Parkin Rabbit pAb (A11172)}

Immunofluorescence - Parkin Rabbit pAb (A11172)

Immunofluorescence analysis of C6 cells using Parkin Rabbit pAb (A11172) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Parkin Rabbit pAb (A11172)}

Immunofluorescence - Parkin Rabbit pAb (A11172)

Immunofluorescence analysis of NIH/3T3 cells using Parkin Rabbit pAb (A11172) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A11172 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PRKN. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PRKN. (Distance between topics and target gene indicate popularity.) PRKN

* Data provided by citexs.com, for reference only.

Publishing research using A11172? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order