Product name | PTPN14 Rabbit pAb |
---|---|
Catalog No. | A12093 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 650-810 of human PTPN14 (NP_005392.2). |
---|---|
Sequence | VRGMEAMTLKSLHLPMARRNTLREQGPPEEGSGSHEVPQLPQYHHKKTFSDATMLIHSSESEEEEEEAPESVPQIPMLREKMEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQASLPPAMARARVLRHGPAKAISMSRTDPPAVNGASLGPSISE |
Gene ID | 5784 |
Swiss prot | Q15678 |
Synonyms | PTPN14; PEZ; PTP36 |
Calculated MW | 135kDa |
Observed MW | 135kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:1000 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | HeLa, MCF7, A-549, K-562 |
Cellular location | Cytoplasm, Nucleus, cytoskeleton |
Submit your question about A12093 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.