Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PTEN Rabbit pAb (A11193)

Review (1) Publications (19) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PTEN Rabbit pAb (A11193)

Western blot analysis of various lysates using PTEN Rabbit pAb (A11193) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - PTEN Rabbit pAb (A11193)

Immunohistochemistry analysis of PTEN in paraffin-embedded human breast cancer using PTEN Rabbit pAb (A11193) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PTEN Rabbit pAb (A11193)

Immunohistochemistry analysis of PTEN in paraffin-embedded human placenta using PTEN Rabbit pAb (A11193) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PTEN Rabbit pAb (A11193)

Immunohistochemistry analysis of PTEN in paraffin-embedded mouse liver using PTEN Rabbit pAb (A11193) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PTEN Rabbit pAb (A11193)

Immunohistochemistry analysis of PTEN in paraffin-embedded rat testis using PTEN Rabbit pAb (A11193) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - PTEN Rabbit pAb (A11193)

Immunofluorescence analysis of U2OS cells using PTEN Rabbit pAb (A11193) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for PTEN Rabbit pAb(A11193)

You may also interested in:

Overview

Product name PTEN Rabbit pAb
Catalog No. A11193
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene was identified as a tumor suppressor that is mutated in a large number of cancers at high frequency. The protein encoded by this gene is a phosphatidylinositol-3, 4, 5-trisphosphate 3-phosphatase. It contains a tensin like domain as well as a catalytic domain similar to that of the dual specificity protein tyrosine phosphatases. Unlike most of the protein tyrosine phosphatases, this protein preferentially dephosphorylates phosphoinositide substrates. It negatively regulates intracellular levels of phosphatidylinositol-3, 4, 5-trisphosphate in cells and functions as a tumor suppressor by negatively regulating AKT/PKB signaling pathway. The use of a non-canonical (CUG) upstream initiation site produces a longer isoform that initiates translation with a leucine, and is thought to be preferentially associated with the mitochondrial inner membrane. This longer isoform may help regulate energy metabolism in the mitochondria. A pseudogene of this gene is found on chromosome 9. Alternative splicing and the use of multiple translation start codons results in multiple transcript variants encoding different isoforms.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human PTEN (NP_000305.3).
Sequence MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHLDYRPVALLFHKMMF
Gene ID 5728
Swiss prot P60484
Synonyms BZS; DEC; CWS1; GLM2; MHAM; TEP1; MMAC1; PTEN1; 10q23del; PTENbeta; PTEN
Calculated MW 47kDa
Observed MW 54kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, NIH/3T3, C6
Cellular location Cytoplasm, Nucleus, PML body, Secreted
Customer validation

WB (H460Homo sapiens, Mus musculus, Capra hircus, Ctenopharyngodon idellus, Homo sapiens, Rattus norvegicus)

IHC (Homo sapiens, Mus musculus)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PTEN Rabbit pAb images

ABclonal:Western blot - PTEN Rabbit pAb (A11193)}

Western blot - PTEN Rabbit pAb (A11193)

Western blot analysis of various lysates using PTEN Rabbit pAb (A11193) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - PTEN Rabbit pAb (A11193)}

Immunohistochemistry - PTEN Rabbit pAb (A11193)

Immunohistochemistry analysis of PTEN in paraffin-embedded human breast cancer using PTEN Rabbit pAb (A11193) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PTEN Rabbit pAb (A11193)}

Immunohistochemistry - PTEN Rabbit pAb (A11193)

Immunohistochemistry analysis of PTEN in paraffin-embedded human placenta using PTEN Rabbit pAb (A11193) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PTEN Rabbit pAb (A11193)}

Immunohistochemistry - PTEN Rabbit pAb (A11193)

Immunohistochemistry analysis of PTEN in paraffin-embedded mouse liver using PTEN Rabbit pAb (A11193) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PTEN Rabbit pAb (A11193)}

Immunohistochemistry - PTEN Rabbit pAb (A11193)

Immunohistochemistry analysis of PTEN in paraffin-embedded rat testis using PTEN Rabbit pAb (A11193) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - PTEN Rabbit pAb (A11193)}

Immunofluorescence - PTEN Rabbit pAb (A11193)

Immunofluorescence analysis of U2OS cells using PTEN Rabbit pAb (A11193) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A11193

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A11193 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PTEN. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PTEN. (Distance between topics and target gene indicate popularity.) PTEN

* Data provided by citexs.com, for reference only.

Publishing research using A11193? Please let us know so that we can cite the reference in this datasheet.

Antibodies (11)

ELISA Kits (1)

Secondary Antibodies (22)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order