Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PRMT5 Rabbit pAb (A1520)

Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PRMT5 Rabbit pAb (A1520)

Western blot analysis of extracts of various cell lines, using PRMT5 antibody (A1520) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).

ABclonal:Immunohistochemistry - PRMT5 Rabbit pAb (A1520)

Immunohistochemistry analysis of paraffin-embedded human placenta using PRMT5 Rabbit pAb (A1520) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PRMT5 Rabbit pAb (A1520)

Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using PRMT5 Rabbit pAb (A1520) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PRMT5 Rabbit pAb (A1520)

Immunohistochemistry analysis of paraffin-embedded rat lung using PRMT5 Rabbit pAb (A1520) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - PRMT5 Rabbit pAb (A1520)

Immunofluorescence analysis of H9C2 cells using PRMT5 Rabbit pAb (A1520) at dilution of 100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - PRMT5 Rabbit pAb (A1520)

Immunofluorescence analysis of L929 cells using PRMT5 Rabbit pAb (A1520) at dilution of 100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - PRMT5 Rabbit pAb (A1520)

Immunofluorescence analysis of U-2 OS cells using PRMT5 Rabbit pAb (A1520) at dilution of 100 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name PRMT5 Rabbit pAb
Catalog No. A1520
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes an enzyme that belongs to the methyltransferase family. The encoded protein catalyzes the transfer of methyl groups to the amino acid arginine, in target proteins that include histones, transcriptional elongation factors and the tumor suppressor p53. This gene plays a role in several cellular processes, including transcriptional regulation, and the assembly of small nuclear ribonucleoproteins. A pseudogene of this gene has been defined on chromosome 4. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human PRMT5 (NP_006100.2).
Sequence MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMH
Gene ID 10419
Swiss prot O14744
Synonyms HSL7; JBP1; SKB1; IBP72; SKB1Hs; HRMT1L5; PRMT5
Calculated MW 73kDa
Observed MW 70kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Jurkat, HepG2, HeLa, NIH/3T3, PC-12, COS-1
Cellular location Cytoplasm, Golgi apparatus, Nucleus
Customer validation

WB (Rattus norvegicus, Mus musculus, Homo sapiens)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PRMT5 Rabbit pAb images

ABclonal:Western blot - PRMT5 Rabbit pAb (A1520)}

Western blot - PRMT5 Rabbit pAb (A1520)

Western blot analysis of extracts of various cell lines, using PRMT5 antibody (A1520) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
ABclonal:Immunohistochemistry - PRMT5 Rabbit pAb (A1520)}

Immunohistochemistry - PRMT5 Rabbit pAb (A1520)

Immunohistochemistry analysis of paraffin-embedded human placenta using PRMT5 Rabbit pAb (A1520) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PRMT5 Rabbit pAb (A1520)}

Immunohistochemistry - PRMT5 Rabbit pAb (A1520)

Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using PRMT5 Rabbit pAb (A1520) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PRMT5 Rabbit pAb (A1520)}

Immunohistochemistry - PRMT5 Rabbit pAb (A1520)

Immunohistochemistry analysis of paraffin-embedded rat lung using PRMT5 Rabbit pAb (A1520) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - PRMT5 Rabbit pAb (A1520)}

Immunofluorescence - PRMT5 Rabbit pAb (A1520)

Immunofluorescence analysis of H9C2 cells using PRMT5 Rabbit pAb (A1520) at dilution of 100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - PRMT5 Rabbit pAb (A1520)}

Immunofluorescence - PRMT5 Rabbit pAb (A1520)

Immunofluorescence analysis of L929 cells using PRMT5 Rabbit pAb (A1520) at dilution of 100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - PRMT5 Rabbit pAb (A1520)}

Immunofluorescence - PRMT5 Rabbit pAb (A1520)

Immunofluorescence analysis of U-2 OS cells using PRMT5 Rabbit pAb (A1520) at dilution of 100 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A1520 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PRMT5. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PRMT5. (Distance between topics and target gene indicate popularity.) PRMT5

* Data provided by citexs.com, for reference only.

Publishing research using A1520? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order