Publications (5) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | PKC alpha Rabbit mAb |
---|---|
Catalog No. | A11107 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0197 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 573-672 of human PKC alpha (P17252). |
---|---|
Sequence | MTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV |
Gene ID | 5578 |
Swiss prot | P17252 |
Synonyms | AAG6; PKCA; PRKACA; PKCI+/-; PKCalpha; PKC-alpha; PKC alpha |
Calculated MW | 77kDa |
Observed MW | 76kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | Testing results |
IHC-P | |
WB | |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunoprecipitation |
Positive samples | HeLa, Jurkat, Mouse brain, Mouse lung, Rat brain |
Cellular location | Cell membrane, Cytoplasm, Mitochondrion membrane, Nucleus, Peripheral membrane protein |
Customer validation | WB (Rattus norvegicus, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A11107 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on PRKCA. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to PRKCA. (Distance between topics and target gene indicate popularity.) PRKCA
* Data provided by citexs.com, for reference only.
Publishing research using A11107? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.