Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

PKC alpha Rabbit mAb (A11107)

Publications (5) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PKC alpha Rabbit mAb (A11107)

Western blot analysis of various lysates using PKC alpha pAb (A11107) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - PKC alpha Rabbit mAb (A11107)

Immunohistochemistry analysis of PKC alpha in paraffin-embedded human liver cancer tissue using PKC alpha Rabbit mAb (A11107) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - PKC alpha Rabbit mAb (A11107)

Immunohistochemistry analysis of PKC alpha in paraffin-embedded mouse liver tissue using PKC alpha Rabbit mAb (A11107) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - PKC alpha Rabbit mAb (A11107)

Immunohistochemistry analysis of PKC alpha in paraffin-embedded rat colon tissue using PKC alpha Rabbit mAb (A11107) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - PKC alpha Rabbit mAb (A11107)

Immunohistochemistry analysis of PKC alpha in paraffin-embedded rat liver tissue using PKC alpha Rabbit mAb (A11107) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunoprecipitation - PKC alpha Rabbit mAb (A11107)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg PKC alpha antibody (A11107). Western blot was performed from the immunoprecipitate using PKC alpha antibody (A11107) at a dilution of 1:1000.

You may also interested in:

Overview

Product name PKC alpha Rabbit mAb
Catalog No. A11107
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0197

Background

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This kinase has been reported to play roles in many different cellular processes, such as cell adhesion, cell transformation, cell cycle checkpoint, and cell volume control. Knockout studies in mice suggest that this kinase may be a fundamental regulator of cardiac contractility and Ca(2+) handling in myocytes.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 573-672 of human PKC alpha (P17252).
Sequence MTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV
Gene ID 5578
Swiss prot P17252
Synonyms AAG6; PKCA; PRKACA; PKCI+/-; PKCalpha; PKC-alpha; PKC alpha
Calculated MW 77kDa
Observed MW 76kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IHC-P Human
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunoprecipitation    
Positive samples HeLa, Jurkat, Mouse brain, Mouse lung, Rat brain
Cellular location Cell membrane, Cytoplasm, Mitochondrion membrane, Nucleus, Peripheral membrane protein
Customer validation

WB (Rattus norvegicus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PKC alpha Rabbit mAb images

ABclonal:Western blot - PKC alpha Rabbit mAb (A11107)}

Western blot - PKC alpha Rabbit mAb (A11107)

Western blot analysis of various lysates using PKC alpha pAb (A11107) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunohistochemistry - PKC alpha Rabbit mAb (A11107)}

Immunohistochemistry - PKC alpha Rabbit mAb (A11107)

Immunohistochemistry analysis of PKC alpha in paraffin-embedded human liver cancer tissue using PKC alpha Rabbit mAb (A11107) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - PKC alpha Rabbit mAb (A11107)}

Immunohistochemistry - PKC alpha Rabbit mAb (A11107)

Immunohistochemistry analysis of PKC alpha in paraffin-embedded mouse liver tissue using PKC alpha Rabbit mAb (A11107) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - PKC alpha Rabbit mAb (A11107)}

Immunohistochemistry - PKC alpha Rabbit mAb (A11107)

Immunohistochemistry analysis of PKC alpha in paraffin-embedded rat colon tissue using PKC alpha Rabbit mAb (A11107) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - PKC alpha Rabbit mAb (A11107)}

Immunohistochemistry - PKC alpha Rabbit mAb (A11107)

Immunohistochemistry analysis of PKC alpha in paraffin-embedded rat liver tissue using PKC alpha Rabbit mAb (A11107) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunoprecipitation - PKC alpha Rabbit mAb (A11107)}

Immunoprecipitation - PKC alpha Rabbit mAb (A11107)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg PKC alpha antibody (A11107). Western blot was performed from the immunoprecipitate using PKC alpha antibody (A11107) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A11107 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PRKCA. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PRKCA. (Distance between topics and target gene indicate popularity.) PRKCA

* Data provided by citexs.com, for reference only.

Publishing research using A11107? Please let us know so that we can cite the reference in this datasheet.

Antibodies (11)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order