Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Calcineurin A Rabbit pAb (A1063)

Publications (6) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - Calcineurin A Rabbit pAb (A1063)

Western blot analysis of extracts of various cell lines, using Calcineurin A antibody (A1063) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunofluorescence - Calcineurin A Rabbit pAb (A1063)

Immunofluorescence analysis of HeLa cells using Calcineurin A antibody (A1063). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Calcineurin A Rabbit pAb
Catalog No. A1063
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables several functions, including ATPase binding activity; calmodulin binding activity; and calmodulin-dependent protein phosphatase activity. Involved in several processes, including calcineurin-NFAT signaling cascade; peptidyl-serine dephosphorylation; and response to calcium ion. Located in several cellular components, including cytosol; dendritic spine; and nucleoplasm. Part of calcineurin complex. Colocalizes with cytoplasmic side of plasma membrane. Implicated in developmental and epileptic encephalopathy 91. Biomarker of focal segmental glomerulosclerosis and schizophrenia.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-511 of human Calcineurin A (NP_001124163.1).
Sequence MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ
Gene ID 5530
Swiss prot Q08209
Synonyms CALN; CCN1; CNA1; CALNA; DEE91; IECEE; PPP2B; ACCIID; CALNA1; IECEE1; Calcineurin A
Calculated MW 59kDa
Observed MW 57kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HeLa, SH-SY5Y, THP-1, A-549, Mouse brain, Mouse lung
Cellular location Cell membrane, Nucleus, sarcolemma
Customer validation

WB (Mus musculus)

IP (Mus musculus)

IF (Homo sapiens)

ChIP (Homo sapiens)

DB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Calcineurin A Rabbit pAb images

ABclonal:Western blot - Calcineurin A Rabbit pAb (A1063)}

Western blot - Calcineurin A Rabbit pAb (A1063)

Western blot analysis of extracts of various cell lines, using Calcineurin A antibody (A1063) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
ABclonal:Immunofluorescence - Calcineurin A Rabbit pAb (A1063)}

Immunofluorescence - Calcineurin A Rabbit pAb (A1063)

Immunofluorescence analysis of HeLa cells using Calcineurin A antibody (A1063). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A1063 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PPP3CA. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PPP3CA. (Distance between topics and target gene indicate popularity.) PPP3CA

* Data provided by citexs.com, for reference only.

Publishing research using A1063? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order