Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PPP1CA Rabbit pAb (A12468)

Publications (5) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PPP1CA Rabbit pAb (A12468)

Western blot analysis of various lysates, using PPP1CA antibody (A12468) at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.5s.

ABclonal:Immunofluorescence - PPP1CA Rabbit pAb (A12468)

Immunofluorescence analysis of PC-12 cells using PPP1CA Rabbit pAb (A12468) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name PPP1CA Rabbit pAb
Catalog No. A12468
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). This broadly expressed gene encodes the alpha subunit of the PP1 complex that associates with over 200 regulatory proteins to form holoenzymes which dephosphorylate their biological targets with high specificity. PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Increased PP1 activity has been observed in the end stage of heart failure. Studies suggest that PP1 is an important regulator of cardiac function and that PP1 deregulation is implicated in diabetes and multiple types of cancer. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 230-330 of human PPP1CA (NP_002699.1).
Sequence EVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK
Gene ID 5499
Swiss prot P62136
Synonyms PP1A; PP-1A; PPP1A; PP1alpha; PPP1CA
Calculated MW 38kDa
Observed MW 38kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples MCF7, HeLa, NIH/3T3, C6
Cellular location Cytoplasm, Nucleus, nucleolus, nucleoplasm
Customer validation

WB (Mus musculus, Homo sapiens, Rattus norvegicus)

IF/ICC (Rattus norvegicus, Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PPP1CA Rabbit pAb images

ABclonal:Western blot - PPP1CA Rabbit pAb (A12468)}

Western blot - PPP1CA Rabbit pAb (A12468)

Western blot analysis of various lysates, using PPP1CA antibody (A12468) at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.5s.
ABclonal:Immunofluorescence - PPP1CA Rabbit pAb (A12468)}

Immunofluorescence - PPP1CA Rabbit pAb (A12468)

Immunofluorescence analysis of PC-12 cells using PPP1CA Rabbit pAb (A12468) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A12468 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PPP1CA. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PPP1CA. (Distance between topics and target gene indicate popularity.) PPP1CA

* Data provided by citexs.com, for reference only.

Publishing research using A12468? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order