Tested applications:WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIPReactivity:Mouse
Product name | PPARα Rabbit pAb |
---|---|
Catalog No. | A6697 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human PPARα (NP_005027.2). |
---|---|
Sequence | MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDE |
Gene ID | 5465 |
Swiss prot | Q07869 |
Synonyms | PPAR; NR1C1; hPPAR; PPARalpha; PPAR alpha; PPARA |
Calculated MW | 18kDa/52kDa |
Observed MW | 52KDa |
Reactivity | Mouse |
---|---|
Tested applications | WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | Mouse liver, Mouse kidney |
Cellular location | Nucleus |
Customer validation | WB(Mus musculus, Rattus norvegicus, Homo sapiens) |
Submit your question about A6697 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A6697? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.