Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PMEPA1 Rabbit pAb (A16555)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Immunohistochemistry - PMEPA1 Rabbit pAb (A16555)

Immunohistochemistry analysis of PMEPA1 in paraffin-embedded rat ovary using PMEPA1 Rabbit pAb (A16555) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PMEPA1 Rabbit pAb (A16555)

Immunohistochemistry analysis of PMEPA1 in paraffin-embedded human placenta using PMEPA1 Rabbit pAb (A16555) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PMEPA1 Rabbit pAb (A16555)

Immunohistochemistry analysis of PMEPA1 in paraffin-embedded mouse lung using PMEPA1 Rabbit pAb (A16555) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name PMEPA1 Rabbit pAb
Catalog No. A16555
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a transmembrane protein that contains a Smad interacting motif (SIM). Expression of this gene is induced by androgens and transforming growth factor beta, and the encoded protein suppresses the androgen receptor and transforming growth factor beta signaling pathways though interactions with Smad proteins. Overexpression of this gene may play a role in multiple types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 173-252 of human PMEPA1 (NP_954638.1).
Sequence PSSNSGISATCYGSGGRMEGPPPTYSEVIGHYPGSSFQHQQSSGPPSLLEGTRLHHTHIAPLESAAIWSKEKDKQKGHPL
Gene ID 56937
Swiss prot Q969W9
Synonyms STAG1; TMEPAI; PMEPA1
Calculated MW 32kDa
Observed MW Refer to figures

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples
Cellular location Early endosome membrane, Golgi apparatus membrane, Single-pass membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PMEPA1 Rabbit pAb images

ABclonal:Immunohistochemistry - PMEPA1 Rabbit pAb (A16555)}

Immunohistochemistry - PMEPA1 Rabbit pAb (A16555)

Immunohistochemistry analysis of PMEPA1 in paraffin-embedded rat ovary using PMEPA1 Rabbit pAb (A16555) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PMEPA1 Rabbit pAb (A16555)}

Immunohistochemistry - PMEPA1 Rabbit pAb (A16555)

Immunohistochemistry analysis of PMEPA1 in paraffin-embedded human placenta using PMEPA1 Rabbit pAb (A16555) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PMEPA1 Rabbit pAb (A16555)}

Immunohistochemistry - PMEPA1 Rabbit pAb (A16555)

Immunohistochemistry analysis of PMEPA1 in paraffin-embedded mouse lung using PMEPA1 Rabbit pAb (A16555) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A16555 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PMEPA1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PMEPA1. (Distance between topics and target gene indicate popularity.) PMEPA1

* Data provided by citexs.com, for reference only.

Publishing research using A16555? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order