Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PLCD4 Rabbit pAb (A7841)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PLCD4 Rabbit pAb (A7841)

Western blot analysis of extracts of various cell lines, using PLCD4 antibody (A7841) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

You may also interested in:

Overview

Product name PLCD4 Rabbit pAb
Catalog No. A7841
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the delta class of phospholipase C enzymes. Phospholipase C enzymes play a critical role in many cellular processes by hydrolyzing phosphatidylinositol 4, 5-bisphosphate into two intracellular second messengers, inositol 1, 4, 5-trisphosphate and diacylglycerol. Expression of this gene may be a marker for cancer.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-290 of human PLCD4 (NP_116115.1).
Sequence MASLLQDQLTTDQDLLLMQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHARQARGSAKPSFSISDVETIRNGHDSELLRSLAEELPLEQGFTIVFHGRRSNLDLMANSVEEAQIWMRGLQLLVDLVTSMDHQERLDQWLSDWFQRGDKNQDGKMSFQEVQRLLHLMNVEMDQEYAFSLFQAADTSQSGTLEGEEFVQFYKALTKRAEVQELFESFSADGQKLTLLEFLDFLQEEQKERDCTSELALELIDRYEPSDSGKLRHVLSMDGFLSYLCSKDGDIFNPACLPIYQ
Gene ID 84812
Swiss prot Q9BRC7
Synonyms PLCD4
Calculated MW 88kDa
Observed MW 110kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples BT-474, THP-1, Mouse brain, Mouse testis, Mouse spinal cord, Rat brain
Cellular location Cytoplasm, Endoplasmic reticulum, Membrane, Nucleus, Peripheral membrane protein

PLCD4 Rabbit pAb images

ABclonal:Western blot - PLCD4 Rabbit pAb (A7841)}

Western blot - PLCD4 Rabbit pAb (A7841)

Western blot analysis of extracts of various cell lines, using PLCD4 antibody (A7841) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Inquire About This Product

Submit your question about A7841 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PLCD4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PLCD4. (Distance between topics and target gene indicate popularity.) PLCD4

* Data provided by citexs.com, for reference only.

Publishing research using A7841? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order