Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PINX1 Rabbit pAb (A17172)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - PINX1 Rabbit pAb (A17172)

Western blot analysis of various lysates using PINX1 Rabbit pAb (A17172) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

You may also interested in:

Overview

Product name PINX1 Rabbit pAb
Catalog No. A17172
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables telomerase RNA binding activity and telomerase inhibitor activity. Involved in several processes, including negative regulation of DNA biosynthetic process; positive regulation of protein localization to nucleolus; and protein localization to organelle. Acts upstream of or within telomere maintenance via telomerase. Located in several cellular components, including chromosomal region; nuclear lumen; and spindle.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 127-328 of human PINX1 (NP_060354.4).
Sequence MKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDASPSTPEENETTTTSAFTIQEYFAKRMAALKNKPQVPVPGSDISETQVERKRGKKRNKEATGKDVESYLQPKAKRHTEGKPERAEAQERVAKKKSAPAEEQLRGPCWDQSSKASAQDAGDHVQPPEGRDFTLKPKKRRGKKKLQKPVEIAEDATLEETLVKKKKKKDSK
Gene ID 54984
Swiss prot Q96BK5
Synonyms Gno1; LPTL; LPTS; Pxr1; PINX1
Calculated MW 37kDa
Observed MW 43kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa, Jurkat, HepG2
Cellular location mitochondrion, nuclear chromosome, nucleolus, nucleoplasm, spindle

Research Area

PINX1 Rabbit pAb images

ABclonal:Western blot - PINX1 Rabbit pAb (A17172)}

Western blot - PINX1 Rabbit pAb (A17172)

Western blot analysis of various lysates using PINX1 Rabbit pAb (A17172) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Inquire About This Product

Submit your question about A17172 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PINX1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PINX1. (Distance between topics and target gene indicate popularity.) PINX1

* Data provided by citexs.com, for reference only.

Publishing research using A17172? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order